Recombinant Pan troglodytes C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

CXCR4 is a G protein-coupled receptor (GPCR) characterized by seven transmembrane domains . It binds specifically to the chemokine CXCL12 (stromal cell-derived factor-1), activating downstream signaling pathways such as RAS-MAPK, PI3K-AKT, and NF-κB, which regulate cell survival, proliferation, and metastasis . In Pan troglodytes, recombinant CXCR4 retains these functional properties, enabling studies on HIV entry mechanisms, cancer biology, and immune cell trafficking .

Production and Purification

Recombinant Pan troglodytes CXCR4 is synthesized using heterologous expression systems. Data from commercial suppliers (Table 1) outline common methodologies:

HIV Entry Studies

CXCR4 serves as a coreceptor for HIV-1 X4 strains, facilitating viral fusion with host cells. Recombinant Pan troglodytes CXCR4 enables comparative studies of HIV tropism and interspecies transmission mechanisms .

Cancer Metastasis

The CXCR4-CXCL12 axis promotes tumor cell migration and angiogenesis. Recombinant chimpanzee CXCR4 is used to model metastasis in primate-specific contexts .

Immunohistochemistry

Antibodies against recombinant CXCR4 (e.g., CSB-RA569311A0HU) are validated for detecting CXCR4 expression in cancer tissues, with staining intensity correlated to disease progression .

Limitations and Future Directions

While recombinant Pan troglodytes CXCR4 is indispensable for primate-specific studies, challenges include:

  • Species-Specific Variants: Genetic distinctions between Pan troglodytes subspecies (e.g., P. t. ellioti) may affect receptor function .

  • Structural Dynamics: Full-length membrane protein purification remains technically demanding .

Ongoing research aims to optimize expression systems and explore therapeutic targeting of CXCR4 in HIV and oncology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special format requests. Please specify your desired format in the order notes for personalized preparation.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
Recombinant Pan troglodytes C-X-C chemokine receptor type 4 (CXCR4) is a receptor for the chemokine CXCL12/SDF-1. It transduces signals by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. It is involved in the AKT signaling cascade and plays a role in regulating cell migration, particularly during wound healing. CXCR4 serves as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. It binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. CXCR4 is involved in hematopoiesis and cardiac ventricular septum formation. It also plays a crucial role in vascularization of the gastrointestinal tract, potentially by regulating vascular branching and/or remodeling processes in endothelial cells. CXCR4 is involved in cerebellar development. In the central nervous system, it may mediate hippocampal-neuron survival.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Q&A

What is the evolutionary significance of CXCR4 in Pan troglodytes subspecies?

CXCR4 is part of a gene family that includes paralogs such as CCR3, CCR9, and CXCR6, which appear to have undergone positive selection during chimpanzee subspecies differentiation. Genetic analysis has revealed distinctive adaptive responses to viral pressures, particularly simian immunodeficiency virus (SIV), between different chimpanzee subspecies. Comparative genomic studies have identified significant differentiation in these genes between eastern and central chimpanzee populations, suggesting virus-driven adaptation has played a key role in shaping genetic diversity in these receptors .

The evolutionary patterns observed in CXCR4 and related genes likely reflect the dynamic co-evolutionary relationship between chimpanzees and viral pathogens. This explains why CXCR4-encoding genes show signatures of selection that differ from background genomic patterns in different Pan troglodytes subspecies (P. t. ellioti, P. t. troglodytes, P. t. verus, and P. t. schweinfurthii) .

How does Pan troglodytes CXCR4 structure compare to human CXCR4?

Pan troglodytes CXCR4 shares high sequence homology with human CXCR4, particularly in conserved functional domains. This conservation is evidenced by the fact that researchers have been able to design gRNAs that target identical sites in both human and Rhesus macaque CXCR4 genes . The high conservation of certain CXCR4 sequences across primate species reflects the essential functional role this receptor plays in immune system signaling.

What experimental techniques are used to isolate and characterize Pan troglodytes CXCR4?

The isolation and characterization of Pan troglodytes CXCR4 typically involves:

  • PCR amplification of the CXCR4 gene from chimpanzee genomic DNA or cDNA libraries

  • Cloning into expression vectors for recombinant protein production

  • Expression in heterologous cell systems (commonly HEK293 or CHO cells)

  • Protein purification using affinity chromatography (often with His-tags or other fusion tags)

  • Validation of receptor function through binding assays with natural ligands (CXCL12/SDF-1)

For functional characterization, researchers commonly employ flow cytometry with fluorescently labeled antibodies to quantify cell surface expression, calcium flux assays to measure receptor activation, and migration assays to assess chemotactic responses . Structural studies may utilize X-ray crystallography or cryo-electron microscopy to determine three-dimensional conformation.

How can CRISPR/Cas9 be used to study CXCR4 function in Pan troglodytes models?

CRISPR/Cas9 technology provides a powerful approach for studying CXCR4 function in Pan troglodytes models through targeted gene editing. The methodology involves:

  • Design of species-specific gRNAs targeting conserved regions of the CXCR4 gene

  • Delivery of CRISPR/Cas9 components via lentiviral vectors to primary chimpanzee cells

  • Verification of editing efficiency using T7EN1 assays to measure insertion/deletion frequencies

  • Isolation of CXCR4-modified cell populations via flow cytometry

  • Functional validation through viral challenge experiments and receptor signaling assays

In detailed studies with human and Rhesus macaque cells, researchers have achieved CXCR4 disruption efficiencies of up to 39.22% depending on the gRNA used . This approach has successfully generated cells resistant to X4-tropic HIV-1 infection, demonstrating the potential for applying similar techniques to chimpanzee models to study species-specific aspects of CXCR4 function and viral pathogenesis.

The analysis of off-target effects is crucial in these experiments. Comprehensive screening of potential off-target sites can be performed using computational prediction tools followed by deep sequencing of identified regions. Studies have shown high specificity with properly designed gRNAs, with negligible off-target mutagenesis detected in transduced cells .

What are the key differences in CXCR4-mediated viral entry between human and Pan troglodytes cells?

CXCR4 functions as a co-receptor for viral entry in both humans and chimpanzees, but important species-specific differences exist:

  • Binding affinity: Subtle variations in the extracellular domains of CXCR4 can affect the binding affinity for viral envelope proteins

  • Post-binding events: Species-specific differences in signaling cascades following receptor engagement

  • Co-receptor preference: HIV-1 isolates show varying tropism for CCR5 versus CXCR4 in different primate species

  • Restriction factors: Species-specific restriction factors may interact differently with CXCR4-mediated entry pathways

Research has demonstrated that most subtype C HIV-1 isolates, regardless of being CCR5-tropic (R5), CXCR4-tropic (X4), or dual/mixed-tropic (DM), showed reduced pathogenic fitness compared to other dominant group M subtypes when tested in human peripheral blood mononuclear cells (PBMCs) . This suggests that receptor-virus interactions have species-specific components that influence viral fitness.

Studies utilizing CXCR4-edited cells have shown that disruption of this receptor can confer protection against X4-tropic HIV-1 infection, with significant reductions in viral replication as measured by p24 antigen ELISA and real-time PCR analysis . This approach provides valuable insights into the comparative role of CXCR4 in viral pathogenesis across primate species.

How do genetic variations in CXCR4 correlate with SIV resistance in different Pan troglodytes subspecies?

Genetic variations in CXCR4 and related chemokine receptor genes appear to correlate with differential SIV susceptibility among Pan troglodytes subspecies. Analysis of these variations reveals:

  • Subspecies-specific genetic adaptations in the CXCR4 gene and its paralogs (CCR3, CCR9, CXCR6)

  • Evidence of positive selection on these genes, suggesting virus-driven evolutionary pressure

  • Correlation between genetic variations and SIV prevalence in different geographical populations

  • Functional consequences of these variations on receptor expression and viral binding

Genomic analyses indicate that SIV has likely been a selective agent in the evolution of chimpanzee subspecies, eliciting distinctive adaptive responses in eastern and central chimpanzee populations . These adaptations may explain observed differences in SIV prevalence and pathogenicity across subspecies.

The genetic distinctions between subspecies (P. t. ellioti, P. t. troglodytes, P. t. verus, P. t. schweinfurthii) extend beyond mitochondrial DNA to nuclear genes including chemokine receptors, highlighting the importance of comprehensive genomic approaches to understanding host-pathogen co-evolution . Geographic barriers, such as the Sanaga River separating P. t. ellioti and P. t. troglodytes populations, have likely contributed to genetic isolation and subsequent adaptive divergence in these genes.

What are the optimal conditions for expressing recombinant Pan troglodytes CXCR4 in heterologous systems?

The optimal expression of recombinant Pan troglodytes CXCR4 in heterologous systems requires careful consideration of several parameters:

ParameterOptimal ConditionsConsiderations
Expression SystemMammalian cell lines (HEK293, CHO)Ensures proper folding and post-translational modifications
Vector DesignCMV promoter, Kozak sequence, C-terminal tagTag position should minimize interference with function
Transfection MethodLipofection or electroporationCell type-dependent optimization required
Culture Conditions37°C, 5% CO₂, DMEM/F-12 with supplementsSupplements include FBS, L-glutamine, antibiotics
Expression Time48-72 hours post-transfectionMonitor for cytotoxicity
Purification StrategyTwo-step approach: affinity followed by size exclusionDetergent selection crucial for membrane protein stability

For functional studies, stable cell lines expressing Pan troglodytes CXCR4 are preferable to transient expression systems, as they provide more consistent receptor levels. Inducible expression systems may be advantageous when studying receptors that might have cytotoxic effects when overexpressed.

Verification of proper protein folding and function should include ligand binding assays with the natural ligand CXCL12/SDF-1, calcium mobilization assays, and surface expression confirmation via flow cytometry with conformation-specific antibodies .

What techniques can be used to analyze CXCR4-mediated signaling pathways in Pan troglodytes cells?

Several complementary techniques can be employed to comprehensively analyze CXCR4-mediated signaling pathways in Pan troglodytes cells:

  • Calcium Flux Assays: Using calcium-sensitive fluorescent dyes (Fluo-4, Fura-2) to measure intracellular calcium mobilization following receptor activation

  • Phosphorylation Analysis: Western blotting or phospho-specific flow cytometry to detect activation of downstream kinases (ERK1/2, Akt, p38 MAPK)

  • G-protein Activation: BRET or FRET-based assays to measure G-protein coupling efficiency

  • β-Arrestin Recruitment: Bioluminescence complementation assays to quantify β-arrestin recruitment kinetics

  • Receptor Internalization: Flow cytometry or confocal microscopy to track receptor endocytosis following ligand binding

  • Transcriptional Profiling: RNA-Seq or qPCR arrays to identify downstream gene expression changes

  • Chemotaxis Assays: Transwell migration assays to assess functional chemotactic responses

When comparing signaling pathways between human and chimpanzee CXCR4, it is essential to use cells with similar receptor expression levels and to conduct dose-response studies across a range of ligand concentrations. Primary cells isolated from Pan troglodytes provide the most physiologically relevant context, though immortalized cell lines may be necessary for certain high-throughput applications .

What are the challenges in assessing CXCR4 polymorphisms across different Pan troglodytes populations?

Assessment of CXCR4 polymorphisms across different Pan troglodytes populations presents several significant challenges:

  • Sample Acquisition: Limited availability of samples from wild chimpanzee populations, particularly from endangered subspecies like P. t. ellioti with approximately 6,500 individuals remaining

  • DNA Quality: Variable quality of DNA from non-invasively collected samples (feces, hair) requiring specialized extraction and amplification protocols

  • Reference Genome Limitations: Incomplete or biased reference genomes that may not capture the full diversity of subspecies

  • Recombination Rate Variation: Differential recombination rates between genic and non-genic regions (1.36 cM/Mb versus 1.61 cM/Mb) affecting population genetic analyses

  • Complex Population History: Admixture between subspecies and historical population bottlenecks complicating interpretation of genetic patterns

  • Functional Validation: Difficulty in experimentally validating the functional significance of identified polymorphisms

To address these challenges, researchers employ a combination of approaches including targeted amplicon sequencing, whole-genome sequencing of representative individuals, and computational methods that account for recombination rate variation and demographic history. Population structure analysis using software like STRUCTURE can help identify admixed individuals and define genetically distinct populations .

When analyzing potential signatures of selection, it's essential to distinguish between selection and demographic effects by comparing patterns at putatively neutral regions with those at the loci of interest. Studies have found that even when controlling for recombination rate differences between genic and non-genic sites, CXCR4 and related genes show evidence of positive selection in certain chimpanzee subspecies .

How can single-cell RNA sequencing enhance our understanding of CXCR4 expression in Pan troglodytes immune cells?

Single-cell RNA sequencing (scRNA-seq) offers unprecedented resolution for investigating CXCR4 expression patterns in Pan troglodytes immune cells:

  • Cell Type-Specific Expression: scRNA-seq can reveal heterogeneity in CXCR4 expression across different immune cell subpopulations, identifying previously unrecognized CXCR4+ populations

  • Temporal Dynamics: When applied to cells at different stages of activation or infection, scRNA-seq can capture the temporal regulation of CXCR4 and associated genes

  • Regulatory Networks: Integration with ATAC-seq or ChIP-seq data enables identification of transcription factors and regulatory elements controlling CXCR4 expression

  • Comparative Analysis: Direct comparison of expression patterns between human and Pan troglodytes at single-cell resolution can highlight species-specific regulatory mechanisms

  • Response to Viral Challenge: Profiling cells before and after viral exposure can identify CXCR4-associated gene modules involved in the response to infection

This approach is particularly valuable for studying rare cell populations that might be missed in bulk RNA sequencing. For example, CXCR4 expression in memory T cell subsets or specialized tissue-resident immune cells might reveal important insights into species-specific immune responses.

The methodology requires careful sample preparation to maintain cell viability and RNA integrity, typically involving isolation of peripheral blood mononuclear cells (PBMCs) or specific immune cell subsets, followed by single-cell isolation (using microfluidic or droplet-based platforms), library preparation, and deep sequencing .

What are the implications of dual-tropic HIV-1 variants for CXCR4 function in comparative primate studies?

Dual-tropic (DM) HIV-1 variants, capable of utilizing both CCR5 and CXCR4 co-receptors, have significant implications for comparative primate studies:

  • Evolutionary Pressure: The existence of dual-tropic viruses suggests evolutionary pressure to maintain flexibility in co-receptor usage, potentially reflecting different selective pressures across primate species

  • Receptor Binding Dynamics: Comparative studies of how dual-tropic variants interact with human versus Pan troglodytes CXCR4 can reveal subtle structural differences in receptor binding sites

  • Transition Mechanisms: Understanding the molecular basis for the R5-to-X4 tropism switch in different primate species may provide insights into viral adaptation mechanisms

  • Therapeutic Implications: Species differences in response to CXCR4 antagonists when challenged with dual-tropic variants have implications for drug development

Research has shown that subtype C HIV-1 isolates, including dual/mixed-tropic variants, generally display lower pathogenic fitness compared to other dominant group M subtypes when tested in human PBMCs . This fitness difference might be influenced by species-specific aspects of CXCR4 structure and function.

The experimental approach to studying dual-tropic variants typically involves isolating primary viral strains from infected individuals, propagating them on PHA/IL-2-treated PBMCs, and characterizing their coreceptor usage through various functional assays. Genetic analysis of the env gene, particularly the V3 loop region, helps identify molecular determinants of dual tropism .

How can comparative analyses of CXCR4 gene editing outcomes in human versus Pan troglodytes cells inform HIV cure strategies?

Comparative analyses of CXCR4 gene editing outcomes between human and Pan troglodytes cells provide valuable insights for HIV cure strategies:

  • Editing Efficiency Differences: Species-specific differences in DNA repair mechanisms may affect CRISPR/Cas9 editing outcomes, informing optimal design of gene editing strategies

  • Off-Target Profiles: Comparing off-target effects between species helps identify conserved safe harbor sites for therapeutic interventions

  • Functional Consequences: Differential effects of identical CXCR4 mutations on viral resistance between species highlight critical functional domains

  • Immune Responses: Species-specific immune reactions to edited cells may inform potential immunogenicity concerns in clinical applications

  • Compensatory Mechanisms: Identification of species differences in how cells compensate for CXCR4 loss can reveal novel therapeutic targets

Studies have demonstrated that CRISPR/Cas9-mediated disruption of CXCR4 can confer resistance to X4-tropic HIV-1 in human cells, with significant reductions in viral replication as measured by p24 antigen ELISA and real-time PCR analysis . Similar approaches have been successfully applied to Rhesus macaque CD4+ T cells, suggesting potential applicability across primate species.

The methodology involves designing gRNAs targeting conserved regions of CXCR4, delivering them via lentiviral vectors, verifying editing efficiency through T7EN1 assays, and functionally validating the edited cells through viral challenge experiments. Importantly, comprehensive off-target analysis using both computational prediction and deep sequencing has demonstrated high specificity with properly designed gRNAs .

What are the key methodological limitations in current Pan troglodytes CXCR4 research?

Current Pan troglodytes CXCR4 research faces several significant methodological limitations:

  • Limited Sample Availability: Restricted access to chimpanzee samples due to ethical considerations and endangered status of wild populations

  • Genetic Diversity Representation: Existing studies often rely on limited numbers of individuals that may not capture the full genetic diversity of Pan troglodytes subspecies

  • in vitro vs. in vivo Discrepancies: Cell culture models may not fully recapitulate the complex in vivo environment of receptor function

  • Cross-Reactivity Issues: Antibodies and other reagents developed for human CXCR4 may have suboptimal specificity or affinity for Pan troglodytes variants

  • Functional Assay Standardization: Lack of standardized assays for measuring CXCR4 function across primate species complicates comparative analyses

  • Genetic Modification Constraints: Ethical and practical limitations on genetic modification experiments in chimpanzees

  • Population Structure Complexity: Incomplete understanding of chimpanzee population structure and history can confound genetic analyses

To address these limitations, researchers are increasingly turning to ex vivo tissue explant models, induced pluripotent stem cell (iPSC) approaches, and advanced computational methods for maximizing information from limited samples. Multi-omics integration combining genomics, transcriptomics, and proteomics data can provide more comprehensive insights than single-technology approaches .

How might novel receptor-ligand interaction technologies advance Pan troglodytes CXCR4 research?

Emerging technologies for studying receptor-ligand interactions promise to significantly advance Pan troglodytes CXCR4 research:

  • Cryo-Electron Microscopy: High-resolution structural determination of CXCR4 in complex with natural ligands and viral proteins, revealing species-specific binding interfaces

  • Surface Plasmon Resonance (SPR): Real-time binding kinetics measurements to quantify species differences in ligand affinity and binding dynamics

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Mapping conformational changes upon ligand binding with peptide-level resolution

  • Nanobody-Based Biosensors: Development of conformation-specific nanobodies to probe receptor activation states in living cells

  • Proximity Labeling Proteomics: Identification of species-specific CXCR4 interaction partners using BioID or APEX approaches

  • Single-Molecule Tracking: Visualization of receptor diffusion, clustering, and internalization dynamics at the plasma membrane

  • AlphaFold and Related AI Tools: Computational prediction of species-specific structural features to guide experimental design

These approaches can help elucidate subtle species differences in CXCR4 function that may impact viral pathogenesis and therapeutic responses. For example, comparative binding studies between human and Pan troglodytes CXCR4 with various HIV envelope proteins could reveal determinants of species-specific viral entry mechanisms .

Implementation of these technologies requires careful optimization for Pan troglodytes samples, often involving preliminary validation using recombinant proteins or cell lines before application to primary cells or tissues.

What interdisciplinary approaches could address current knowledge gaps in Pan troglodytes CXCR4 biology?

Addressing knowledge gaps in Pan troglodytes CXCR4 biology requires innovative interdisciplinary approaches:

  • Evolutionary Genomics + Structural Biology: Combining evolutionary sequence analysis with structural modeling to identify functionally significant amino acid substitutions

  • Immunology + Computational Biology: Integration of immune profiling data with systems biology approaches to model receptor signaling networks

  • Virology + Population Genetics: Correlating geographic distribution of viral strains with genetic variation in host receptors to identify co-evolutionary patterns

  • Single-Cell Technologies + Spatial Transcriptomics: Mapping CXCR4 expression in tissue contexts to understand microenvironmental regulation

  • Organoid Models + CRISPR Engineering: Development of chimpanzee-derived organoids with engineered CXCR4 variants to study function in tissue-like environments

  • Paleogenomics + Contemporary Sampling: Comparing ancient and modern Pan troglodytes DNA to track evolutionary trajectories of chemokine receptors

  • Conservation Biology + Molecular Epidemiology: Monitoring disease prevalence in wild populations in relation to receptor polymorphisms

These interdisciplinary approaches can help contextualize molecular findings within broader evolutionary and ecological frameworks. For example, combining population genetics with structural biology could help identify whether CXCR4 variants that differ between chimpanzee subspecies affect protein function in ways relevant to viral susceptibility .

Collaborative research networks involving primatologists, molecular biologists, structural biologists, and computational scientists are essential for implementing these interdisciplinary approaches effectively and ethically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.