Recombinant Pan troglodytes C-X-C chemokine receptor type 6 (CXCR6)

Shipped with Ice Packs
In Stock

Description

Sequence Alignment:

The recombinant chimpanzee CXCR6 shares high homology with human CXCR6 (UniProt ID: O00574), differing in species-specific residues that influence ligand affinity and coreceptor functionality .

Functional Roles

CXCR6 interacts with its sole ligand, CXCL16, to mediate immune cell migration and activation. Key functions include:

Immune Regulation:

  • T Cell Positioning: Directs CD8+ effector memory T cells (Tem) to tissues like the liver, spleen, and lungs .

  • Dendritic Cell Interaction: Facilitates cross-talk between T cells and dendritic cells via CXCL16-CXCR6 signaling .

Viral Pathogenesis:

  • Coreceptor for Lentiviruses: Serves as an entry coreceptor for SIV strains (e.g., SIVagmSab, SIVsmm) and HIV-2 .

  • Species-Specific Usage: Unlike HIV-1, which predominantly uses CCR5, SIVcpz evolved to lose CXCR6 dependency, likely due to residue Pro326 in its V3 loop .

Disease Associations:

  • Cancer: Overexpressed in prostate, gastric, and osteosarcoma tumors, promoting proliferation and invasion .

  • Chronic Inflammation: Elevated CXCR6 levels in COPD patients correlate with systemic inflammation and cardiovascular risks .

Research Applications

Recombinant chimpanzee CXCR6 is pivotal in studying viral entry mechanisms and immune responses.

Experimental Uses:

  • Viral Entry Assays: Evaluates coreceptor efficiency for SIV/HIV strains .

  • Ligand Binding Studies: Characterizes CXCL16-CXCR6 interactions using surface plasmon resonance (SPR) or flow cytometry .

  • Therapeutic Development: Targets for monoclonal antibodies (e.g., mAb 20D8) to block viral entry or modulate immune responses .

Key Research Findings:

Study FocusMethodologyOutcomeSource
SIV Coreceptor UsageCXCR6 blocking with CXCL16Inhibited SIVagmSab replication in PBMCs
CXCR6 Expression in SM LymphocytesFlow cytometry with mAb 20D8CXCR6+ CD4+ Tem cells enriched in sooty mangabeys
Cancer ProgressionIn vitro invasion assaysCXCR6/CXCL16 enhanced prostate cancer metastasis

Pathway Involvement

CXCR6 participates in critical signaling pathways:

  • Chemokine Signaling: Mediates leukocyte migration via CXCL16 binding .

  • GPCR Downstream Signaling: Activates MAPK/ERK and PI3K/Akt pathways .

  • Viral Entry: Cooperates with CD4 for SIV/HIV fusion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR6; BONZO; STRL33; C-X-C chemokine receptor type 6; CXC-R6; CXCR-6; G-protein coupled receptor STRL33; G-protein coupled receptor bonzo; CD antigen CD186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MAEHDYHEDYGFNSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKLIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Uniprot No.

Target Background

Function
CXCR6 is a receptor for the C-X-C chemokine CXCL16. It acts as a coreceptor for SIVs and certain strains of HIV-2 and m-tropic HIV-1.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural difference between Pan troglodytes CXCR6 and other chemokine receptors?

CXCR6 from Pan troglodytes, like its human counterpart, possesses unique structural features that distinguish it from other chemokine receptors. Most notably, CXCR6 lacks the conserved cysteine residues in the N-terminus and third extracellular loop that are present in all other described chemokine receptors . This structural uniqueness may contribute to its specialized functions in immune cell trafficking and viral pathogenesis.

The receptor maintains the characteristic seven-transmembrane domain structure of G protein-coupled receptors but with these distinct modifications. When expressing recombinant Pan troglodytes CXCR6, researchers should be mindful of these structural differences when designing constructs, particularly if chimeric receptors or tagged versions are being developed for experimental purposes.

How does sequence homology between human and Pan troglodytes CXCR6 compare?

Alignment analyses of human and Pan troglodytes CXCR6 sequences reveal a high degree of homology across most regions, reflecting the evolutionary conservation of this receptor . The most significant difference appears in the 5' UTR regulatory region, where an approximately 320 bp sequence present in Pan troglodytes is absent in Homo sapiens . This difference may contribute to species-specific expression patterns and regulation.

The coding regions show particularly high conservation, suggesting functional constraints on CXCR6 structure. The table below summarizes key comparative features:

RegionHomology LevelNotable Differences
Coding sequenceHighMinimal amino acid substitutions
5' UTRModerate~320 bp sequence in Pan troglodytes absent in humans
Intronic regionsVariableTG/TA repeat region differences
Ligand binding domainVery highFunctionally conserved

This high degree of conservation facilitates translational research between chimpanzee models and human applications, though regulatory differences should be considered when studying expression patterns.

What is the principal ligand for Pan troglodytes CXCR6 and how does binding compare to human CXCR6?

The primary ligand for Pan troglodytes CXCR6 is CXCL16, mirroring the ligand specificity observed with human CXCR6. CXCL16 is unusual among chemokines as it exists in both membrane-bound and soluble forms . The membrane-bound form serves as an adhesion molecule, while the soluble form acts as a traditional chemokine attractant.

Binding studies suggest comparable affinity between human and Pan troglodytes CXCR6 for CXCL16, consistent with the high sequence conservation in the ligand-binding domains. This interaction triggers similar downstream signaling pathways, including calcium mobilization and MAP kinase activation, in both species.

The CXCR6-CXCL16 interaction appears to be particularly important in T cell positioning and retention in tissues, with significant roles in both viral defense and tumor immunology . When working with recombinant Pan troglodytes CXCR6, researchers should verify ligand binding properties if introducing mutations or modifications to ensure functional integrity is maintained.

What expression systems are most effective for producing functional recombinant Pan troglodytes CXCR6?

The optimal expression system for recombinant Pan troglodytes CXCR6 depends on the experimental objectives and downstream applications. Several systems have demonstrated effectiveness, each with particular advantages:

  • Mammalian expression systems: HEK293 and CHO cells provide native-like post-translational modifications and correct protein folding, making them preferred for functional studies. Transient transfection with optimized vectors containing strong promoters (CMV or EF1α) typically yields moderate expression levels sufficient for most applications.

  • Insect cell systems: Sf9 or High Five insect cells infected with baculovirus vectors can produce higher protein yields while maintaining proper folding of CXCR6. This system is particularly useful when larger quantities of protein are required for structural studies.

  • Escherichia coli: While challenging for full-length membrane proteins, E. coli systems can be used for expressing specific domains of CXCR6 or for isotopic labeling for NMR studies.

For most immunological research applications, mammalian expression systems provide the best balance of yield and native-like protein characteristics. The inclusion of a cleavable affinity tag (e.g., His6 or FLAG) facilitates purification while allowing tag removal for functional studies.

How can researchers confirm proper folding and functionality of recombinant Pan troglodytes CXCR6?

Verifying the proper folding and functionality of recombinant Pan troglodytes CXCR6 is crucial before experimental use. A methodical approach employing multiple complementary techniques provides the most reliable assessment:

Researchers should implement at least three of these approaches to comprehensively validate their recombinant CXCR6 preparations before proceeding to more complex experimental applications.

How does Pan troglodytes CXCR6 mediate T cell trafficking compared to human CXCR6?

Pan troglodytes CXCR6 appears to function similarly to human CXCR6 in mediating T cell trafficking, particularly in tissue-specific homing. Both direct comparative studies and parallel investigations in each species support this functional conservation.

CXCR6 plays a critical role in directing CD8+ T cells to specific tissue niches, particularly in response to inflammation or infection. In both humans and chimpanzees, CXCR6 expression is associated with tissue-resident memory T cell (TRM) populations . These CXCR6+ CD8+ T cells localize in distinct perivascular niches in tissues where they interact with CXCL16-expressing cells .

The mechanistic pathway involves several coordinated steps:

  • Upregulation of CXCR6 on activated T cells, often in response to cytokines like IL-12

  • Migration toward CXCL16 gradients produced in inflamed tissues

  • Retention in tissues through interaction with membrane-bound CXCL16

  • Development of tissue-residency programs, including downregulation of tissue egress receptors

This process appears conserved between species, with CXCR6+ T cells playing similar roles in viral control in both humans and non-human primates . The primary difference may lie in the regulatory regions of the gene as noted earlier, potentially affecting expression patterns rather than the fundamental trafficking function.

What role does Pan troglodytes CXCR6 play in viral infections compared to human CXCR6?

Pan troglodytes CXCR6, like human CXCR6, functions as a coreceptor for several viruses, though with potential species-specific differences in utilization efficiency. Studies indicate that CXCR6 serves as a secondary coreceptor for HIV-1, HIV-2, and numerous SIV strains .

In SIV infection models using African green monkeys and sooty mangabeys (though not specifically Pan troglodytes), CXCR6 has been shown to effectively function as a coreceptor when CCR5 expression is low . This suggests an important evolutionary role for CXCR6 in viral pathogenesis across primates.

The table below summarizes comparative viral interaction characteristics:

VirusHuman CXCR6 RolePan troglodytes CXCR6 RoleFunctional Significance
HIV-1Secondary coreceptorSecondary coreceptorAlternative entry pathway
HIV-2Major coreceptorPresumed major coreceptorMay contribute to differential pathogenesis
SIVUsed by numerous strainsUsed by numerous strainsPotentially enables infection of CCR5-negative cells
PolyomavirusT cell recruitment to infected kidneyPresumed similar functionCritical for viral control in kidney tissue

Beyond serving as a viral entry coreceptor, CXCR6 plays a critical role in the antiviral immune response. In polyomavirus infections, CXCR6 mediates T cell recruitment to and retention in the infected kidney . Absence of CXCR6 impairs viral control, highlighting its importance in the antiviral immune response .

How can researchers effectively manipulate CXCR6 expression in T cells for experimental studies?

Researchers can employ several methodological approaches to manipulate CXCR6 expression in T cells for experimental studies, each with specific applications:

  • Cytokine conditioning: IL-12 treatment has been demonstrated to upregulate CXCR6 expression on virus-specific CD8+ T cells both in vitro and in vivo . For experimental protocols, treatment with 10-50 ng/ml recombinant IL-12 during T cell activation can significantly enhance CXCR6 expression.

  • Genetic modification:

    • Overexpression: Lentiviral or retroviral vectors containing Pan troglodytes CXCR6 under constitutive or inducible promoters can establish stable expression.

    • Knockdown/Knockout: CRISPR-Cas9 targeting of CXCR6 or shRNA approaches can reduce or eliminate expression.

  • Selective expansion: Culture conditions favoring expansion of CXCR6+ subsets, such as using specific cytokine cocktails (IL-15, TGF-β) that promote tissue-resident memory phenotypes, can enrich for CXCR6-expressing populations .

  • Ex vivo modification for adoptive transfer: T cells can be genetically modified ex vivo to express recombinant Pan troglodytes CXCR6 before adoptive transfer in experimental models, potentially enhancing tissue homing capabilities .

When designing these experimental approaches, researchers should consider possible differences between in vitro and in vivo regulation of CXCR6, as well as potential compensatory mechanisms that may emerge following manipulation of this receptor's expression.

What are the most effective approaches for studying the CXCR6-CXCL16 axis in tumor microenvironments?

Studying the CXCR6-CXCL16 axis in tumor microenvironments requires a multi-faceted approach combining in vitro, ex vivo, and in vivo methodologies:

  • Single-cell RNA sequencing of tumor tissues: This provides comprehensive expression mapping of CXCR6, CXCL16, and associated pathway components within the heterogeneous tumor microenvironment. Analysis should include clustering to identify specific cell populations expressing these molecules.

  • Spatial transcriptomics and imaging: Techniques such as multiplexed immunofluorescence or imaging mass cytometry allow visualization of CXCR6+ cells relative to CXCL16-expressing cells within the tumor architecture. This reveals spatial relationships crucial for understanding functional interactions .

  • Functional T cell recruitment assays: Tumor spheroid models with engineered gradients of CXCL16 can assess the migratory capacity of CXCR6+ T cells in a three-dimensional context.

  • In vivo modulation of the axis:

    • Neutralizing antibodies against CXCL16 can disrupt the axis to assess impact on immune infiltration

    • Administration of recombinant CXCL16 can potentially enhance CXCR6+ T cell recruitment

    • Engineered T cells with enhanced CXCR6 expression may show improved tumor infiltration

Studies have shown that CXCR6 positions CD8+ cytotoxic T cells in distinct perivascular niches of the tumor stroma populated by dendritic cells (DC3) that express CXCL16 . These DC3s trans-present IL-15 to CXCR6+ T cells, sustaining their survival in the tumor microenvironment . Leveraging this knowledge, researchers can design experiments targeting this specific cellular interaction.

How do genetic variations in CXCR6 impact its function in different experimental systems?

Genetic variations in CXCR6 can significantly impact receptor function across experimental systems, necessitating careful consideration when designing studies with recombinant Pan troglodytes CXCR6.

Multiple SNPs and haplotypes have been identified in the CXCR6 gene, with varying frequencies across populations . Three major haplotypes have been detected in human populations (Hap-1, Hap-2, and Hap-3), with differential distribution between ethnic groups . While comprehensive data on Pan troglodytes haplotypes is more limited, the high sequence homology suggests similar variation may exist.

Key considerations when accounting for genetic variations include:

  • Coding region SNPs: Mutations in the coding region may alter:

    • Ligand binding affinity

    • Signaling efficiency

    • Receptor internalization kinetics

    • Protein stability

  • Regulatory region variations: The ~320 bp sequence present in Pan troglodytes but absent in humans in the 5' UTR regulatory region may influence expression levels and tissue-specific patterns .

  • Intronic variations: The region consisting of consecutive "TG" and "TA" repeats shows substantial variability and may affect splicing efficiency or mRNA stability .

To account for these variations in experimental systems, researchers should:

  • Sequence verify all recombinant constructs

  • Consider testing multiple natural variants when studying receptor function

  • Include appropriate controls when comparing across species

  • Document the specific variant being used in all reports

What methodological approaches best measure CXCR6-mediated signaling in primary cells versus cell lines?

Measuring CXCR6-mediated signaling requires different methodological approaches when working with primary cells compared to established cell lines, particularly when using recombinant Pan troglodytes CXCR6:

For primary cells (e.g., isolated T cells):

  • Calcium flux assays: Load cells with ratiometric calcium indicators (Fura-2AM) to measure immediate signaling responses. Primary cells typically show more variable responses, requiring larger sample sizes (n≥10) and careful normalization to baseline.

  • Phospho-flow cytometry: Detect phosphorylation of downstream signaling molecules (pERK, pAkt, pSTAT) at single-cell resolution. This is particularly valuable for primary cells due to heterogeneous expression of CXCR6.

  • Real-time cell migration: Use transwell systems or microfluidic devices with CXCL16 gradients to assess functional signaling outcomes. Primary cells typically require pre-activation and careful timing of assays (optimal window: 3-7 days post-activation for T cells).

  • Gene expression analysis: Measure activation of CXCR6-dependent genes using qPCR or RNA-seq at multiple time points (1, 4, 24 hours) to capture both immediate-early and delayed responses.

For cell lines:

  • Reporter systems: Develop stable cell lines with pathway-specific reporters (e.g., NFAT-luciferase) to measure receptor activity with greater throughput.

  • BRET/FRET assays: These proximity-based assays allow real-time monitoring of receptor-effector interactions and are more readily implemented in stable cell lines.

  • Electrophysiology: Patch-clamp recordings can measure ion channel activities downstream of CXCR6 activation in cell lines with more consistent membrane properties.

The key differences in approach reflect the greater heterogeneity, limited availability, and shorter experimental window available with primary cells compared to the more homogeneous, abundant, and stable cell lines.

What are the key differences in the genomic organization of CXCR6 between Pan troglodytes and Homo sapiens?

The most significant distinction is a sequence of approximately 320 bp immediately upstream from an indel-rich region that is present in Pan troglodytes but absent in Homo sapiens 5' UTR regulatory region . This difference may influence species-specific gene regulation and expression patterns.

The table below summarizes key genomic differences:

FeaturePan troglodytesHomo sapiensPotential Functional Impact
5' UTR regulatory regionContains ~320 bp sequenceLacks this sequenceMay affect transcription factor binding and expression regulation
TG/TA repeat regionPresentPresent with higher variabilityPotential impact on mRNA stability or regulatory element binding
Coding exon structureHighly conservedHighly conservedMinimal impact on protein structure
3' UTRSimilar with minor variationsContains SNPs (e.g., rs2234358)May affect mRNA stability and translation efficiency

These genomic differences should be considered when designing expression constructs for recombinant Pan troglodytes CXCR6, particularly regarding the choice of regulatory elements to drive expression.

How do CXCR6 haplotypes differ between species and what are the functional implications?

Haplotype analysis reveals distinct patterns of genetic variation in CXCR6 between human populations, providing insight into potential functional differences that may also apply to Pan troglodytes CXCR6.

In human populations, three major CXCR6 haplotypes have been identified :

  • Hap-1: Comprises four SNPs (rs3774640, rs3774638, rs2234351, and rs936939) located upstream from the CXCR6 ORF, found at similar frequencies in black (14.6%) and Caucasian (20.0%) populations.

  • Hap-2: Details not fully specified in the available data.

  • Hap-3: A four-SNP haplotype (rs55920693, rs6785091, rs56332428, and rs71325095) spanning both the CXCR6 5' and 3' flanking regions, with significant frequency differences between populations.

While comprehensive haplotype data specifically for Pan troglodytes is limited in the provided sources, the high sequence homology suggests some conservation of haplotype structure, potentially with species-specific variations.

Functional implications of these haplotype differences may include:

  • Differential expression levels: Haplotypes affecting regulatory regions may influence baseline and inducible expression levels of CXCR6.

  • Variable response to stimuli: Different haplotypes may respond distinctly to inflammatory signals or cytokine stimulation.

  • Altered binding properties: Though coding region is highly conserved, subtle variations may affect receptor-ligand interactions or downstream signaling efficiency.

  • Species-specific viral interactions: Given CXCR6's role as a viral coreceptor, haplotype differences may contribute to species-specific susceptibilities to viral infections .

When working with recombinant Pan troglodytes CXCR6, researchers should document the specific haplotype being studied and consider how it may influence experimental outcomes.

How can studies of Pan troglodytes CXCR6 inform therapeutic approaches for kidney diseases?

Studies of Pan troglodytes CXCR6 provide valuable insights that can inform therapeutic approaches for kidney diseases, particularly those involving viral infections or immune-mediated pathology.

The CXCR6-CXCL16 axis plays a critical role in T cell trafficking to the kidney during infection. BK polyomavirus (BKPyV)-associated nephropathy, a leading cause of kidney allograft loss, involves virus-specific T cell responses that are regulated by this chemokine axis . Mouse models using murine polyomavirus (a natural pathogen that persists in the kidney similar to human BKPyV) demonstrate that CXCR6 is required for CD4+ and CD8+ T cells to be recruited to and retained in the kidney, respectively .

Therapeutic approaches that could emerge from this understanding include:

  • Enhanced T cell therapies: Conditioning BKPyV-specific T cells with IL-12 prior to adoptive transfer could increase CXCR6-mediated migration to the kidney and improve virus control in kidney transplant patients with resurgent BKPyV replication .

  • Pathway modulation: Selectively enhancing the CXCR6-CXCL16 axis could improve viral clearance in cases of persistent infection. Conversely, interrupting this axis through systemic administration of neutralizing CXCL16 antibodies could potentially reduce anti-donor T cell infiltrates in kidney allografts .

  • Engineered T cells: Enforced expression of CXCR6 in BKPyV-specific T cells could facilitate their infiltration into renal allografts with polyomavirus-associated nephropathy .

  • Biomarkers: CXCR6 and CXCL16 expression levels could serve as biomarkers for T cell infiltration and disease progression in kidney transplant patients.

Transcriptional analysis of kidney biopsies from patients with polyomavirus-associated nephropathy shows significant upregulation of CXCR6 and CXCL16 , validating the translational relevance of findings from Pan troglodytes and mouse models to human disease.

What insights does Pan troglodytes CXCR6 provide for cancer immunotherapy approaches?

Research on Pan troglodytes CXCR6 offers valuable insights for cancer immunotherapy approaches, particularly regarding T cell trafficking and retention within tumor tissues.

CXCR6 positions CD8+ cytotoxic T cells in a distinct perivascular niche of the tumor stroma populated by dendritic cells (DC3) that express CXCL16 . These DC3s trans-present IL-15 to CXCR6+ T cells, sustaining their survival in the tumor microenvironment and preventing activation-induced cell death .

These findings translate to several potential immunotherapy strategies:

  • Enhanced CAR-T cell therapy: Engineering chimeric antigen receptor (CAR) T cells to express CXCR6 could improve their infiltration into CXCL16-expressing tumors. Studies have shown that CAR-T cells lacking CXCR6 show poorer tumor infiltration compared to their wild-type counterparts .

  • Vaccination strategies: Intranasal vaccination preferentially elicits tissue-resident memory T cells with high CXCR6 expression . This approach could be leveraged for cancer vaccines targeting lung and other mucosal tissue cancers.

  • Combinatorial approaches: Ionizing radiation increases CXCL16 expression in tumor cells , suggesting that combining radiotherapy with CXCR6-expressing T cell therapies could enhance treatment efficacy.

  • Targeting the immunosuppressive tumor microenvironment: CXCR6+ CD8+ T cells of resident phenotype participate in controlling primary tumor proliferation and metastasis . Therapies that enhance CXCR6 expression on tumor-infiltrating lymphocytes could potentially overcome aspects of tumor-induced immunosuppression.

The conservation of CXCR6 structure and function between Pan troglodytes and humans supports the translational potential of these approaches, though species-specific differences in regulatory regions should be considered when extrapolating experimental findings.

What are common pitfalls when expressing recombinant Pan troglodytes CXCR6 and how can they be addressed?

Expressing recombinant Pan troglodytes CXCR6 presents several technical challenges that researchers should anticipate and address:

  • Low expression levels: As a seven-transmembrane protein, CXCR6 can be difficult to express at high levels.

    • Solution: Optimize codon usage for the expression system, use strong promoters, and consider fusion partners that enhance expression (e.g., GPCR fusion proteins like T4-lysozyme for structural studies).

  • Misfolding in heterologous systems: Improper folding can occur particularly in prokaryotic systems.

    • Solution: Prefer mammalian or insect cell expression systems that provide appropriate chaperones and post-translational modifications. Consider using inducible expression systems with lower temperatures (28-30°C) during the induction phase.

  • Protein aggregation: Membrane proteins can aggregate during solubilization and purification.

    • Solution: Screen multiple detergents and lipid compositions. Glycerol (5-10%) and stabilizing ligands can improve stability during purification.

  • Loss of function during purification: Native conformation and function can be compromised during extraction from membranes.

    • Solution: Validate function at each purification step using ligand binding assays. Consider fluorescent ligands for binding validation.

  • Difficulty distinguishing endogenous from recombinant CXCR6: This can complicate functional studies.

    • Solution: Use epitope tags (HA, FLAG) or species-specific antibodies that can differentiate between endogenous human and recombinant Pan troglodytes CXCR6.

  • Regulatory element incompatibility: The differences in 5' UTR between human and Pan troglodytes may affect expression.

    • Solution: Use heterologous promoters known to work well in the chosen expression system rather than relying on native regulatory elements.

By anticipating these challenges and implementing appropriate solutions, researchers can improve the success rate of recombinant Pan troglodytes CXCR6 expression studies.

How can researchers effectively detect and quantify CXCR6 gene expression in different experimental systems?

Effective detection and quantification of CXCR6 gene expression requires selecting appropriate methods based on the experimental system and research questions:

  • Quantitative PCR (qPCR):

    • Develop species-specific primers that can distinguish Pan troglodytes CXCR6 from human or other orthologues.

    • For absolute quantification, create standard curves using plasmid DNA containing the target sequence.

    • Recommended reference genes: GAPDH, β-actin, and at least one tissue-specific stable reference gene.

    • Typical threshold cycles for CXCR6 in T cells range from 25-30 depending on activation state.

  • Digital PCR:

    • Provides absolute quantification without standard curves.

    • Particularly useful for low-abundance transcripts or samples with PCR inhibitors.

    • Requires less optimization than qPCR but needs specialized equipment.

  • Real-time CT shift PCR assays:

    • Can detect specific SNPs like rs2234355 and rs2234358 in the CXCR6 ORF and 3' UTR .

    • Involves allele-specific PCR with modified primers containing lock nucleic acid (LNA).

    • Provides both detection and quantification of specific variants.

  • RNA-Seq:

    • Offers comprehensive transcriptome analysis including splicing variants.

    • Requires bioinformatic pipeline optimization for accurate CXCR6 quantification.

    • Enables discovery of novel regulatory RNAs affecting CXCR6 expression.

  • Flow cytometry (protein level):

    • Use commercially available anti-CXCR6 antibodies validated for cross-reactivity with Pan troglodytes.

    • Provides single-cell resolution of protein expression.

    • Can be combined with functional markers to correlate expression with cellular phenotype.

  • Single-cell RNA-Seq:

    • Reveals cell-specific expression patterns and heterogeneity.

    • Particularly valuable for complex tissues or mixed cell populations.

    • Requires specialized analysis pipelines to account for dropout events.

Each method has specific advantages and limitations, and researchers should select based on their specific research questions, available samples, and required sensitivity.

What are promising approaches for studying the role of CXCR6 in viral pathogenesis across primate species?

Several promising approaches can advance our understanding of CXCR6's role in viral pathogenesis across primate species, including Pan troglodytes:

  • Comparative receptor utilization studies:

    • Generate pseudotyped viruses expressing envelope proteins from different viral strains

    • Test entry efficiency in cells expressing CXCR6 from different primate species

    • Identify species-specific differences in coreceptor utilization efficiency

  • CRISPR-engineered primate models:

    • Create CXCR6-modified cells or animals to study viral pathogenesis

    • Introduce human CXCR6 variants into non-human primate cells to assess functional differences

    • Engineer specific mutations to test the importance of key receptor domains

  • Organoid systems:

    • Develop kidney, liver, or lymphoid tissue organoids incorporating CXCR6-expressing immune cells

    • Compare viral infection dynamics across organoids derived from different primate species

    • Test interventions targeting the CXCR6-CXCL16 axis in a physiologically relevant system

  • Systems biology approaches:

    • Apply multi-omics profiling to compare host responses to viral infection across species

    • Construct network models of CXCR6-dependent immune responses

    • Identify conserved vs. species-specific signaling pathways

  • Evolutionary analyses:

    • Conduct comprehensive phylogenetic analyses of CXCR6 across primate species

    • Identify signatures of selection that may relate to viral resistance

    • Correlate receptor polymorphisms with species-specific viral susceptibilities

The unique role of CXCR6 as both a viral coreceptor and a mediator of antiviral T cell responses makes it particularly interesting for comparative studies . Understanding species-specific differences could reveal important insights into viral pathogenesis and potentially identify novel therapeutic targets.

How might structural studies of Pan troglodytes CXCR6 inform drug discovery efforts?

Structural studies of Pan troglodytes CXCR6 could significantly inform drug discovery efforts by revealing conserved binding pockets and species-specific differences that impact ligand interactions:

  • Comparative structural analysis:

    • Determine crystal or cryo-EM structures of Pan troglodytes CXCR6 in comparison with human CXCR6

    • Identify conserved structural elements across species that could serve as robust drug targets

    • Map species-specific differences that might impact drug binding or efficacy

  • Ligand binding studies:

    • Characterize the binding site for CXCL16 to identify key interaction residues

    • Perform computational docking studies with potential small molecule modulators

    • Use mutagenesis to validate predicted binding interactions

  • Allosteric modulator discovery:

    • Identify potential allosteric binding sites that differ from the orthosteric CXCL16 binding site

    • Screen for compounds that can stabilize active or inactive conformations

    • Develop positive or negative allosteric modulators rather than direct agonists or antagonists

  • Structure-based drug design:

    • Apply fragment-based approaches to develop leads targeting specific CXCR6 domains

    • Design peptidomimetics based on CXCL16 interaction epitopes

    • Develop bispecific molecules targeting CXCR6 and partner proteins

  • Antibody development:

    • Use structural information to guide development of therapeutic antibodies

    • Target specific epitopes to modulate rather than completely block receptor function

    • Design species cross-reactive antibodies for preclinical testing

The high sequence conservation between human and Pan troglodytes CXCR6 suggests that structural insights from the chimpanzee receptor would likely translate well to human applications. Additionally, understanding subtle structural differences could help explain species-specific responses to viral infections and inform the development of broadly effective antiviral strategies targeting this receptor.

What are the most important considerations when designing experiments with recombinant Pan troglodytes CXCR6?

When designing experiments with recombinant Pan troglodytes CXCR6, researchers should carefully consider several critical factors to ensure robust and translatable results. The CXCR6-CXCL16 axis represents an important immunological pathway with implications for viral infections, tumor immunology, and tissue-specific T cell responses .

Researchers must first consider the specific expression system, carefully selecting between mammalian, insect, or prokaryotic systems based on their experimental objectives. The high sequence homology between human and Pan troglodytes CXCR6 facilitates comparative studies, though key regulatory regions differ between species, potentially affecting expression patterns .

Functional validation through multiple complementary assays is essential before proceeding to complex experimental applications. When studying CXCR6-mediated signaling, different methodological approaches are required for primary cells versus cell lines, reflecting their distinct biological characteristics.

For studies investigating the role of CXCR6 in disease models, the significant upregulation of CXCR6 and CXCL16 observed in conditions like polyomavirus-associated nephropathy provides a strong foundation for translational research . The unique ability of CXCR6 to position T cells in specific tissue niches through interaction with CXCL16-expressing cells offers promising avenues for targeted therapeutic interventions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.