Recombinant Pan troglodytes D (2) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

The Recombinant Pan troglodytes DRD2 is a full-length protein comprising 443 amino acids, with a calculated molecular weight of approximately 50.6 kDa based on homology to human DRD2 . Key features include:

PropertyDetails
Source OrganismPan troglodytes (Chimpanzee)
Expression SystemEscherichia coli (E. coli)
TagN-terminal 10xHis tag for purification and detection
Sequence CoverageFull-length (1–443 aa)
Storage-20°C (short-term); -80°C for extended storage; avoid repeated freeze-thaw

The amino acid sequence begins with MDPLNLSWYDDDLERQNWSRPF..., consistent with the canonical DRD2 structure . Its seven transmembrane domains enable G-protein coupling, primarily inhibiting adenylyl cyclase via Gi/o proteins .

Drug Development and Screening

  • Antipsychotics: DRD2 is the primary target of antipsychotic drugs like risperidone, which stabilizes the inactive conformation .

  • Parkinson’s Disease: Agonists (e.g., bromocriptine) activate DRD2 to alleviate motor symptoms .

Disease Modeling

  • Cancer: DRD2 overexpression in breast cancer (BrCa) correlates with improved survival and chemosensitivity to paclitaxel . In glioblastoma (GBM), DRD2 activation promotes tumor-initiating cell proliferation via hypoxia-inducible factor 1α (HIF1α) .

  • Neuropsychiatric Disorders: Dysregulated DRD2 signaling is implicated in schizophrenia and addiction .

Signaling Pathways

  • Akt/GSK3 Regulation: DRD2 activation dephosphorylates huntingtin via PPM/PP2C phosphatases, independent of β-arrestin .

  • NF-κB Modulation: DRD2 inhibits NF-κB signaling in BrCa by interacting with β-arrestin2 and DDX5 .

Breast Cancer Sensitivity to Chemotherapy

Ectopic DRD2 expression in BrCa cells reduced tumorigenesis by inducing apoptosis and necroptosis. This effect was mediated through β-arrestin2-dependent suppression of NF-κB .

Glioblastoma Stemness

DRD2 activation in glioma-initiating cells (GICs) enhanced sphere-forming capacity and tumor engraftment in mice, linking dopaminergic signaling to cancer stem cell maintenance .

Technical Considerations

  • Purification: The N-terminal His tag facilitates affinity chromatography .

  • Activity Assays: Functional studies require reconstitution into lipid bilayers to mimic native membrane environments .

Limitations and Future Directions

While recombinant DRD2 enables high-throughput drug screening, its E. coli-derived form lacks post-translational modifications (e.g., glycosylation) present in mammalian systems . Future work may employ mammalian expression systems or cryo-EM structures to resolve active-state conformations for improved drug design.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize the development of your specified tag.
Synonyms
DRD2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
Uniprot No.

Target Background

Function
This dopamine receptor exerts its activity through G proteins, which subsequently inhibit adenylyl cyclase. It plays a positive role in the postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity downstream of OPN5.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Pan troglodytes DRD2 and how does it compare to human DRD2?

The Pan troglodytes D (2) dopamine receptor (DRD2) is a G-protein-coupled receptor belonging to the D2-like family of dopamine receptors. Like human DRD2, it exhibits the archetypal topology consisting of seven transmembrane domains characteristic of G-protein coupled receptors. The receptor functions by inhibiting adenylyl cyclase activity through coupling with inhibitory G-proteins (Gi/o), thereby reducing intracellular cAMP levels .

Pan troglodytes DRD2 shows high sequence homology to human DRD2, reflecting their close evolutionary relationship. The receptor's structure includes:

  • N-terminal extracellular domain

  • Seven transmembrane α-helical domains

  • Three extracellular loops

  • Three intracellular loops (with the third intracellular loop being particularly important for G-protein coupling)

  • C-terminal intracellular domain with palmitoylation sites

The receptor undergoes post-translational palmitoylation, which is required for proper localization to the plasma membrane and stability. This modification is carried out by palmitoylation enzymes including ZDHHC4, ZDHHC3, and ZDHHC8 .

What are the optimal expression systems for producing recombinant Pan troglodytes DRD2, and what are their comparative advantages?

Multiple expression systems are available for recombinant Pan troglodytes DRD2 production, each offering distinct advantages:

Expression SystemAdvantagesDisadvantagesApplications
E. coliHigh yield, low cost, rapid productionLimited post-translational modifications, potential improper foldingProtein fragment studies, antibody production
YeastEukaryotic post-translational modifications, moderate yieldMore complex than E. coliStructural studies, ligand binding assays
BaculovirusHigh expression levels, most eukaryotic PTMsHigher cost, longer production timeFunctional studies, complex interaction analyses
Mammalian CellNative-like folding and processing, all PTMsHighest cost, lowest yieldSignaling studies, drug screening
Cell-Free ExpressionRapid production, easier membrane protein expressionLimited post-translational modificationsRapid screening, difficult-to-express proteins

Commercial sources offer Pan troglodytes DRD2 expressed in these systems with purities of ≥85% as determined by SDS-PAGE . For functional studies, CHO-K1 cells co-expressing DRD2 with Gα15 have been successfully used to develop stable cell lines for drug screening and functional assays .

What purification protocols yield the highest purity of recombinant Pan troglodytes DRD2?

The optimal purification protocol depends on the expression system and intended application. Based on available data, standard purification achieves ≥85% purity as determined by SDS-PAGE . The following approaches are recommended:

For His-tagged recombinant DRD2:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or Co-NTA resins for primary purification

  • Size Exclusion Chromatography (SEC) as a secondary step to remove aggregates and impurities

  • Optional ion exchange chromatography for highest purity needs

To optimize membrane protein purification:

  • Use mild detergents (DDM, LMNG, or CHS) during solubilization

  • Maintain temperature at 4°C throughout purification

  • Include glycerol (10%) and reducing agents in buffers for stability

  • Consider lipid nanodiscs for native-like environment

For antibody-based approaches, immunogen affinity chromatography has been successfully applied for DRD2 antibodies . Quality control should include SDS-PAGE analysis, Western blotting with DRD2-specific antibodies, and functional validation through ligand binding assays.

What experimental methods are most effective for validating the functionality of recombinant Pan troglodytes DRD2?

Multiple complementary approaches should be employed to comprehensively validate DRD2 functionality:

  • G-protein Activation Assays:

    • GTPγS binding assays to measure G-protein coupling efficiency

    • BRET-based G-protein dissociation assays for real-time activation monitoring

  • Second Messenger Assays:

    • cAMP inhibition assays (DRD2 activation inhibits adenylyl cyclase)

    • Ca²⁺ mobilization assays in cells co-expressing DRD2 with Gα15

  • Receptor Binding Assays:

    • Saturation binding with radioligands (e.g., [³H]spiperone)

    • Competition binding with unlabeled ligands to determine pharmacological profile

  • Downstream Signaling Assays:

    • Western blot analysis for phosphorylation of downstream effectors

    • Monitoring activation of the Akt-GSK3 signaling pathway

Research has shown that DRD2 signals through two main pathways: G-protein-dependent signaling (inhibition of adenylyl cyclase) and G-protein-independent arrestin signaling . Both pathways should be evaluated when characterizing receptor function, as they may lead to different behavioral effects and could provide targets for developing more selective therapeutics with fewer side effects .

What techniques can distinguish between D2L and D2S splice variants in Pan troglodytes, and what are their functional differences?

DRD2 exists in two main splice isoforms with distinct functions: D2 long (D2L) and D2 short (D2S, lacking exon 6) . Distinguishing between these variants requires specific methodological approaches:

Molecular Biology Approaches:

  • RT-PCR using primers flanking exon 6 (absent in D2S)

  • qPCR with variant-specific primers

  • RNA-Seq analysis with splice junction mapping

Protein Detection Methods:

  • Western blotting (challenging due to small size difference)

  • Mass spectrometry to detect peptides unique to D2L (from exon 6)

Functional Discrimination:

  • D2L and D2S show differential G-protein coupling profiles

  • D2S typically exhibits stronger presynaptic autoreceptor function

Functional Differences:

  • D2L contains an additional 29 amino acids in the third intracellular loop

  • D2L is predominantly expressed postsynaptically

  • D2S is predominantly expressed presynaptically

  • D2S shows higher affinity for dopamine and more efficient G-protein coupling

  • D2L shows stronger β-arrestin recruitment

Research has shown that intronic single-nucleotide polymorphisms (SNPs rs2283265 and rs1076560) alter D2S/D2L splicing, reducing formation of D2S relative to D2L. These polymorphisms are significantly overrepresented in cocaine abusers compared to controls in Caucasian populations , suggesting functional significance of the D2S/D2L ratio.

How do the pharmacological properties of Pan troglodytes DRD2 compare to other species' DRD2 receptors?

The pharmacological properties of DRD2 show evolutionary conservation with some species-specific variations:

SpeciesKey CharacteristicsPharmacological Considerations
Pan troglodytesHigh homology to humanSimilar pharmacological profile to human DRD2
HumanReference standardWell-characterized pharmacology, target for antipsychotics
Other primates (e.g., Chlorocebus aethiops)Very similar to human/chimpSimilar pharmacological profile, minor differences
Non-primate mammals (e.g., Mustela putorius furo)Moderate differencesSome differences in binding pocket may affect drug responses
Birds (e.g., Meleagris gallopavo)More divergentGreater pharmacological differences expected
Fish (e.g., Takifugu rubripes)Substantial divergenceSignificantly different pharmacological profile

Pan troglodytes DRD2 represents the closest pharmacological match to human DRD2, making it valuable for translational studies. When characterizing the pharmacology of Pan troglodytes DRD2:

  • Compare binding affinities of standard dopaminergic ligands

  • Assess G-protein coupling efficiency

  • Evaluate arrestin recruitment capabilities

  • Determine potency/efficacy ratios for both signaling pathways

For dopamine receptor antagonists, D2 receptor occupancy has been linked to cognitive function in schizophrenia research, with specific occupancy thresholds associated with therapeutic effects versus side effects . Similar pharmacological principles likely apply to Pan troglodytes DRD2 given the high sequence conservation.

How can recombinant Pan troglodytes DRD2 be utilized in neuroinflammation research?

Recent research has revealed that DRD2 plays important roles in neuroinflammatory processes, opening new research directions:

Experimental approaches for studying DRD2 in neuroinflammation:

  • In vitro models:

    • Microglial cultures expressing DRD2

    • Astrocyte-neuron co-cultures

    • Brain slice preparations

  • In vivo models:

    • Intracerebral hemorrhage (ICH) models

    • Inflammatory challenge models (LPS, TNF-α)

    • Neurodegeneration models

Key experimental findings:

  • DRD2 and its downstream protein CRYAB are upregulated in the injured hemisphere after ICH

  • Exogenous administration of DRD2 agonists (quinpirole and ropinirole) demonstrates neuroprotective effects

  • Activation of DRD2 suppresses neuroinflammation through specific signaling pathways

Experimental design considerations:

  • Use specific DRD2 agonists like quinpirole (1-5 mg/kg) or ropinirole (5 mg/kg)

  • Consider both intraperitoneal and intranasal delivery methods

  • Validate with behavioral tests (modified Garcia test, forelimb placement)

  • Assess brain edema and inflammatory marker expression

  • Utilize DRD2 siRNA and CRYAB siRNA for mechanistic validation

These approaches allow investigation of Pan troglodytes DRD2's role in neuroinflammatory processes and development of potential therapeutic strategies for neuroinflammatory conditions.

What are the known functional polymorphisms affecting Pan troglodytes DRD2, and how do they compare to human polymorphisms?

While extensive data on Pan troglodytes DRD2 polymorphisms is limited, we can draw insights from human studies that may guide comparative research:

Human DRD2 Polymorphisms with Functional Significance:

  • Intronic Splice-Affecting Polymorphisms:

    • rs2283265 (intron 5) and rs1076560 (intron 6) alter D2S/D2L splicing

    • These SNPs reduce formation of D2S relative to D2L

    • Associated with cocaine abuse in Caucasian populations (rs2283265: 25% in abusers vs 9% in controls)

    • Allele frequencies vary by population (18% in Caucasians vs 7% in African Americans)

  • Promoter Polymorphisms:

    • Affect DRD2 expression levels

    • May influence response to dopaminergic drugs

  • Coding Region Polymorphisms:

    • Alter receptor function or stability

    • Some variants associated with psychiatric disorders

Research approaches for Pan troglodytes DRD2 polymorphism studies:

  • Comparative genomic analysis between human and Pan troglodytes DRD2

  • Screening for orthologous polymorphisms in chimpanzee populations

  • Functional characterization of identified variants using recombinant expression

  • Differential allelic expression studies to identify cis-acting regulatory elements

Current research indicates that cis-acting loci affect DRD2 expression, as evidenced by differential expression of alleles in brain tissue . Similar regulatory mechanisms likely exist in Pan troglodytes, though direct experimental confirmation is needed.

What are the primary signal transduction pathways activated by Pan troglodytes DRD2, and how can they be experimentally measured?

DRD2 activates multiple signal transduction pathways that can be experimentally characterized:

  • G-protein dependent pathways:

    • Inhibition of adenylyl cyclase via Gαi/o

    • Activation of K⁺ channels via Gβγ

    • Inhibition of Ca²⁺ channels via Gβγ

    • Activation of phospholipase C via Gβγ

  • G-protein independent pathways:

    • β-arrestin recruitment

    • Formation of signaling complex with Akt, PP2A, and GSK3β

    • Regulation of MAPK/ERK pathway

Experimental methods to measure these pathways:

Signaling PathwayMeasurement TechniqueReadoutKey Controls
Gi/o activation[³⁵S]GTPγS bindingG-protein activationPertussis toxin (inhibits Gαi/o)
cAMP inhibitionBRET/FRET cAMP sensorsDecreased cAMPForskolin (activates adenylyl cyclase)
K⁺ channel activationPatch-clamp electrophysiologyHyperpolarizationBa²⁺ (blocks K⁺ channels)
Ca²⁺ channel inhibitionCa²⁺ imaging, electrophysiologyDecreased Ca²⁺ influxBay K8644 (Ca²⁺ channel activator)
β-arrestin recruitmentBRET assaysProtein-protein interactionBiased ligands (G-protein vs arrestin)
Akt/GSK3 signalingPhospho-specific Western blotAltered phosphorylationWortmannin (PI3K inhibitor)

Research has shown that DRD2 receptors send signals through these two main pathways with different behavioral effects, suggesting the possibility of developing more targeted therapeutics with fewer side effects by selectively activating specific pathways .

In recombinant systems, Ca²⁺ responses can be measured when DRD2 is co-expressed with promiscuous G proteins like Gα15, allowing for real-time monitoring of receptor activation .

What structural biology techniques are most effective for studying Pan troglodytes DRD2, and what insights can they provide?

Advanced structural biology techniques offer powerful approaches to study DRD2 structure-function relationships:

  • X-ray Crystallography:

    • Requires large quantities of highly purified, stable protein

    • Often utilizes fusion partners (T4 lysozyme, BRIL) to stabilize the receptor

    • Has been successfully applied to other GPCRs including human dopamine receptors

    • Provides atomic-level resolution of receptor structure

  • Cryo-Electron Microscopy (Cryo-EM):

    • Increasingly powerful for membrane protein structures

    • Can capture different conformational states

    • Requires less protein than crystallography

    • Can visualize receptor-G protein complexes

  • Nuclear Magnetic Resonance (NMR):

    • Useful for studying receptor dynamics

    • Can investigate ligand binding in solution

    • Requires isotopically labeled protein

  • Molecular Dynamics Simulations:

    • Computational approach to study receptor dynamics

    • Can model ligand binding and conformational changes

    • Requires experimental structures as starting points

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Probes protein dynamics and conformational changes

    • Can identify regions affected by ligand binding

    • Requires less protein than crystallography or NMR

Structural insights enable:

  • Identification of ligand binding pockets

  • Understanding of activation mechanisms

  • Design of more selective drugs

  • Exploration of species differences in drug responses

  • Investigation of receptor oligomerization

When studying recombinant Pan troglodytes DRD2, researchers should consider the receptor's membership in the G-protein coupled receptor 1 family and its characteristic seven transmembrane domain topology that is evolutionarily conserved across species .

How can recombinant Pan troglodytes DRD2 research contribute to understanding human dopamine-related disorders?

Recombinant Pan troglodytes DRD2 research offers valuable insights into human dopamine-related disorders due to high evolutionary conservation:

  • Schizophrenia Research:

    • DRD2 is a primary target for antipsychotic medications

    • D2 receptor occupancy correlates with cognitive function in schizophrenia

    • Comparative studies can identify conserved mechanisms of antipsychotic action

  • Parkinson's Disease Applications:

    • DRD2 agonists are key treatments for Parkinson's disease

    • Recombinant receptor studies can evaluate drug efficacy and mechanisms

    • Comparative analysis may reveal species-specific responses to dopaminergic agents

  • Addiction Studies:

    • DRD2 polymorphisms affect vulnerability to substance abuse

    • Intronic polymorphisms affecting splicing are overrepresented in cocaine abusers

    • Recombinant systems allow investigation of how genetic variants alter receptor function

  • Neuroinflammatory Conditions:

    • DRD2 activation suppresses neuroinflammation after intracerebral hemorrhage

    • DRD2 agonists (quinpirole, ropinirole) show therapeutic potential in brain injury

    • Understanding DRD2's role may lead to novel anti-inflammatory approaches

  • Translational Research:

    • Development of biased ligands that selectively activate beneficial signaling pathways

    • Testing of novel therapeutic compounds with improved specificity

    • Investigation of side effect mechanisms (weight gain, movement disorders)

The close evolutionary relationship between Pan troglodytes and human DRD2 makes this research particularly valuable for translational applications, while allowing for controlled experimental conditions that may not be possible in human studies.

What determines G-protein coupling specificity of Pan troglodytes DRD2, and how can this be experimentally manipulated?

G-protein coupling specificity of DRD2 involves complex structural determinants that can be experimentally investigated:

Key Determinants of G-protein Coupling:

  • Intracellular Loops:

    • The third intracellular loop (IL3) plays a critical role in G-protein coupling specificity

    • The D2L variant contains an additional 29 amino acids in IL3 compared to D2S

    • IL3 contains sites for interactions with G-proteins and other signaling proteins

  • C-terminal Tail:

    • Contains phosphorylation sites that regulate desensitization and internalization

    • Mutations in this region can alter G-protein coupling efficiency

  • Transmembrane Domains:

    • TM5, TM6, and TM7 undergo conformational changes upon activation

    • These changes expose binding sites for G-protein interaction

Experimental Manipulation Approaches:

  • Site-Directed Mutagenesis:

    • Targeted mutations in IL3 or C-terminal domains

    • Creation of chimeric receptors with segments from other GPCRs

    • Mutation of key residues in the "DRY" motif at the cytoplasmic end of TM3

  • Expression System Modification:

    • Co-expression with different G-protein subunits

    • Expression in cell lines lacking specific G-proteins

    • Use of pertussis toxin to inactivate Gi/o proteins

  • Pharmacological Manipulation:

    • Use of biased ligands that preferentially activate G-protein or arrestin pathways

    • Application of G-protein or arrestin pathway inhibitors

  • Measuring Coupling Efficiency:

    • GTPγS binding assays

    • BRET/FRET-based G-protein activation sensors

    • Measurement of downstream effectors (cAMP, Ca²⁺, ERK phosphorylation)

Research has shown that in the distal Lys369LysAlaThrGln373 region, mutations can significantly affect G-protein activation . Additionally, studies have demonstrated that DRD2 can signal via G-protein-independent arrestin pathways, offering opportunities for pathway-selective drug development .

Understanding G-protein coupling specificity is crucial for developing more selective therapeutic agents with improved efficacy and reduced side effects.

What are the optimal experimental designs for utilizing recombinant Pan troglodytes DRD2 in drug discovery applications?

Effective drug discovery applications using recombinant Pan troglodytes DRD2 require careful experimental design:

  • Cell-Based Screening Systems:

    • Stable cell lines expressing DRD2 (CHO-K1/D2/Gα15 is well-validated)

    • Inducible expression systems to control receptor density

    • Reporter gene assays linked to specific signaling pathways

    • BRET/FRET-based assays for real-time monitoring

  • Primary Screening Assays:

    • Calcium mobilization assays when DRD2 is co-expressed with Gα15

    • cAMP inhibition assays (measure inhibition of forskolin-stimulated cAMP)

    • β-arrestin recruitment assays

    • Radioligand binding displacement assays

  • Secondary/Confirmatory Assays:

    • GTPγS binding to measure direct G-protein activation

    • ERK phosphorylation

    • Receptor internalization

    • Electrophysiological measurements in native neurons

  • Counter-Screening:

    • Testing against related dopamine receptors (D1, D3, D4, D5)

    • Screening against other monoamine receptors (serotonin, adrenergic)

    • Off-target effect evaluation using receptor panels

  • Advanced Pharmacological Characterization:

    • Bias factor calculation (G-protein vs. arrestin pathway activation)

    • Residence time measurements (receptor-ligand complex stability)

    • Allosteric modulator identification

Practical Implementation Guidelines:

  • Maintain stable cell lines within 16 passages for consistent results

  • Include positive controls (quinpirole, bromocriptine) and reference antagonists (haloperidol, raclopride)

  • Use multiple concentrations to generate full dose-response curves

  • Normalize responses to a reference compound

  • Include appropriate vehicle controls

This approach allows for comprehensive evaluation of compound activity at Pan troglodytes DRD2, identifying compounds with desired efficacy, selectivity, and signaling profiles. The high similarity between Pan troglodytes and human DRD2 makes this a valuable translational research tool.

What methodologies best characterize alternative splicing of Pan troglodytes DRD2, and what functional impact does this have?

Alternative splicing of DRD2 produces functionally distinct receptor variants that require specialized methodologies for characterization:

Analysis Techniques:

  • Molecular Detection Methods:

    • RT-PCR using primers spanning exon 6 (present in D2L, absent in D2S)

    • Quantitative real-time PCR with splice variant-specific primers

    • Droplet digital PCR for absolute quantification of splice variant ratio

    • RNA-Seq with specialized splice junction analysis

  • Protein Level Detection:

    • Western blotting (challenging due to small size difference)

    • Mass spectrometry to identify isoform-specific peptides

    • Immunoprecipitation with variant-specific antibodies

  • Functional Characterization:

    • Electrophysiological recordings to detect presynaptic vs. postsynaptic effects

    • G-protein coupling efficiency measurements

    • Arrestin recruitment assays

    • Receptor trafficking studies

Impact of Alternative Splicing:

The D2L and D2S variants differ by 29 amino acids in the third intracellular loop, resulting in several functional differences:

CharacteristicD2S (Short)D2L (Long)
Predominant LocationPresynaptic (autoreceptor)Postsynaptic
Dopamine AffinityHigherLower
G-protein CouplingMore efficientLess efficient
Arrestin RecruitmentWeakerStronger
Desensitization RateFasterSlower
Signaling BiasG-protein biasedMore balanced

Research has shown that intronic polymorphisms (rs2283265 and rs1076560) affect the splicing of human DRD2, reducing formation of D2S relative to D2L. These polymorphisms are significantly overrepresented in cocaine abusers compared to controls in Caucasian populations . Similar genetic regulation mechanisms may exist in Pan troglodytes, though specific investigation is needed.

The ratio of D2S/D2L can significantly impact dopaminergic signaling and responses to dopaminergic drugs, making alternative splicing a critical consideration in DRD2 research and drug development.

What quality control measures ensure the reliable production and characterization of recombinant Pan troglodytes DRD2?

Rigorous quality control is essential for reliable recombinant DRD2 research:

  • Expression System Validation:

    • Verification of expression vector sequence

    • Confirmation of cell line authenticity

    • Mycoplasma testing of host cells

    • Passage number monitoring (stability typically maintained for 16 passages)

  • Protein Production Quality Control:

    • SDS-PAGE analysis (target: ≥85% purity)

    • Western blot using validated DRD2 antibodies

    • Mass spectrometry to confirm identity and integrity

    • Glycosylation analysis for mammalian expression systems

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Fluorescence spectroscopy to assess tertiary folding

    • Thermal stability assays

    • Limited proteolysis to verify correct folding

  • Functional Validation:

    • Radioligand binding assays (saturation and competition)

    • G-protein activation assays (GTPγS binding)

    • Second messenger assays (cAMP inhibition)

    • Calcium mobilization when co-expressed with Gα15

  • Storage and Stability:

    • Optimized freezing media (45% culture medium, 45% FBS, 10% DMSO)

    • Proper storage conditions (liquid nitrogen for long-term storage)

    • Stability testing over time and freeze-thaw cycles

    • Batch-to-batch consistency evaluation

  • Documentation Requirements:

    • Comprehensive record-keeping of expression conditions

    • Detailed purification protocols

    • Quality control test results for each batch

    • Standard operating procedures (SOPs) for all processes

Implementation of these quality control measures ensures that research conducted with recombinant Pan troglodytes DRD2 is reliable and reproducible. Commercial providers typically perform these validations, with product specifications including host cell information, gene accession numbers, purification methods, and functional validation data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.