Recombinant Pan troglodytes Duffy antigen/chemokine receptor (DARC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

DARC, encoded by the ACKR1 gene, is a seven-transmembrane receptor expressed on erythrocytes, endothelial cells, and neuronal cells. It binds proinflammatory chemokines (e.g., CCL2, CXCL8) and serves as the primary entry receptor for Plasmodium vivax and Plasmodium knowlesi merozoites via interactions with the Duffy Binding Protein (DBP) .

Key Features of DARCDetails
StructureN-terminal extracellular domain with Fy(a/b) antigens; 7 transmembrane helices; lacks DRY motif for G-protein signaling .
FunctionChemokine scavenger; mediates leukocyte trafficking; critical for P. vivax erythrocyte invasion .
PolymorphismsFYB(ES)* allele (erythroid-silent) confers resistance to P. vivax in populations of African descent .

Recombinant DARC Systems and Applications

Recombinant DARC is produced in heterologous systems (e.g., K562 cells, E. coli) to study ligand binding, structural interactions, and malaria invasion mechanisms.

Expression and Purification

  • Expression: Recombinant DARC is often expressed in mammalian cells (e.g., HEK293) or E. coli, with glycosylation critical for proper folding .

  • Purification: Affinity chromatography using anti-Fy6 monoclonal antibodies (e.g., 2C3) yields highly purified DARC, which migrates as a 40–47 kDa band in SDS-PAGE .

Role in Malaria

  • P. vivax Invasion: DARC is essential for P. vivax merozoite entry into reticulocytes. Duffy-negative individuals (Fy(a−b−)) are resistant to infection .

  • P. knowlesi Infection: DARC also mediates P. knowlesi invasion, though less is known about its zoonotic transmission .

Chemokine Regulation

DARC internalizes chemokines (e.g., CXCL1, CXCL8) but does not signal via G-proteins. Instead, it facilitates chemokine transcytosis across endothelial cells, modulating leukocyte migration .

Research Challenges and Future Directions

  • Species-Specific DARC: Limited data exist on Pan troglodytes (chimpanzee) DARC. Comparative studies are needed to assess evolutionary conservation and malaria susceptibility in non-human primates .

  • Therapeutic Targets: Blocking DBP-DARC interactions remains a focus for P. vivax vaccine development. Recombinant DARC is pivotal for testing inhibitors and understanding cross-species transmission .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYDANLEAAAPCHSCNLLDDS ALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPILAPGL GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALL TLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMSILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLARQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Uniprot No.

Target Background

Function
The Duffy antigen/chemokine receptor (DARC) is an atypical chemokine receptor that regulates chemokine levels and localization by high-affinity chemokine binding. This binding is uncoupled from conventional ligand-driven signal transduction cascades, instead leading to chemokine sequestration, degradation, or transcytosis. DARC is also known as an interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. DARC exhibits a promiscuous chemokine-binding profile, interacting with inflammatory chemokines from both the CXC and CC subfamilies but not with homeostatic chemokines. It acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. DARC may regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, it serves as a blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Database Links
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.

Q&A

What is the Duffy antigen/chemokine receptor (DARC) and what is its significance in research?

The Duffy antigen receptor, also known as FY glycoprotein or CD234, is a seven transmembrane protein expressed primarily at the surface of red blood cells. It displays promiscuous binding to multiple chemokines and serves as the basis of the Duffy blood group system. DARC acts as the primary attachment site for malarial parasites on erythrocytes . Unlike typical G protein-coupled receptors (GPCRs), DARC does not exhibit canonical second messenger responses such as calcium release, likely due to a lack of G protein coupling. It also appears to lack β-arrestin binding, making it an enigmatic 7TM chemokine receptor .

Research significance extends beyond malarial studies, as DARC is expressed in multiple cell types including epithelial cells of lung and kidney, endothelial cells of capillaries, hair cells of cochlea, airway smooth muscle cells, and selected regions of brain .

How does DARC differ between humans and chimpanzees (Pan troglodytes)?

While the search results don't directly compare human and chimpanzee DARC proteins themselves, they provide insights into functional differences through their interaction with Plasmodium vivax parasites. The key difference emerges in how these parasites have evolved to interact with DARC in different host species.

Chimpanzee P. vivax parasites maintain intact reticulocyte binding proteins (RBPs) - specifically RBP2d, RBP2e, and RBP3 - that have been pseudogenized (rendered non-functional) in all human P. vivax strains . This suggests potential structural or functional differences in Pan troglodytes DARC that may maintain selective pressure for these parasite proteins to remain functional in chimpanzee-infecting strains while becoming dispensable in human-infecting strains.

What is the structural architecture of DARC and how does it determine function?

DARC exhibits a seven transmembrane (7TM) architecture similar to GPCRs, but with crucial structural differences that explain its unique functionality. Cryo-EM studies of human DARC in complex with the C-C type chemokine CCL7 reveal:

  • A relatively superficial binding mode for chemokines, with the N-terminus of the receptor serving as the key interaction interface

  • A partially formed orthosteric binding pocket lacking the second site for chemokine recognition compared to prototypical chemokine receptors

  • A dramatic shortening of TM5 and TM6 on the intracellular side compared to conventional GPCRs

This structural arrangement precludes coupling of canonical signal-transducers including G proteins, GRKs, and β-arrestins, explaining DARC's inability to trigger typical GPCR signaling cascades despite efficiently binding chemokines .

What experimental approaches are recommended for studying binding properties of recombinant Pan troglodytes DARC?

When investigating the binding properties of recombinant Pan troglodytes DARC, researchers should consider a multi-faceted experimental approach:

  • Recombinant protein expression and purification: Express N-terminal domains of DARC in bacterial systems for subsequent erythrocyte-binding studies. Ensure proper protein folding by assessing α-helical and β-sheet content similar to validations performed for P. vivax RBP proteins .

  • Cell-binding assays: Utilize both native and reticulocyte-enriched erythrocytes from different species (human, chimpanzee, gorilla) to assess binding specificity. Enrichment can be achieved using Percoll density gradients, though researchers should be aware that differences in erythrocyte density between species may affect enrichment efficiency .

  • Structural characterization methods:

    • Cryo-EM: Determine the structure of recombinant Pan troglodytes DARC in complex with various chemokines to identify binding interfaces and structural differences from human DARC .

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry): Employ this technique to uncover ligand-induced structural changes in the receptor, providing insights into the promiscuous nature of chemokine binding .

  • Functional cellular assays: Despite DARC's lack of canonical signaling, design assays to assess potential non-canonical signaling pathways or functional consequences of ligand binding.

How should researchers approach experimental design when studying recombinant Pan troglodytes DARC?

Robust experimental design is critical for obtaining reliable results when studying recombinant Pan troglodytes DARC. Researchers should implement the following best practices:

  • Clear hypothesis formulation: Explicitly state research questions before designing experiments to avoid confirmation bias and ensure methodological decisions are driven by scientific inquiry .

  • Methodology matrix development: Create a comprehensive methodology matrix table that operationalizes variables, clearly documenting scales of measurement, indicators from conceptual frameworks, methods of data collection, and methods of analysis4.

  • Control selection: Carefully choose appropriate control groups, as this selection significantly affects the strength of correlations and may determine whether effects are observed at all .

  • Comparative approach: Include both human and chimpanzee DARC in parallel experiments to directly compare binding properties, structural characteristics, and functional outcomes.

  • Multiple chemokine testing: Given DARC's promiscuous binding profile, test multiple chemokines of different classes (CC, CXC) to comprehensively characterize binding patterns and potential differences between human and chimpanzee DARC.

  • Documentation transparency: Record all methodological decisions in detail, as small variations in experimental design can significantly affect outcomes and may explain contradictory results between studies .

How can researchers interpret contradictory results in DARC research?

When faced with contradictory findings in DARC research, systematic analysis of methodological differences is essential:

What analytical approaches should be used to compare structural differences between human and Pan troglodytes DARC?

Comprehensive structural comparison requires multiple complementary techniques:

  • Sequence-based analysis:

    • Conduct detailed sequence alignments to identify amino acid differences

    • Perform evolutionary conservation analysis to highlight functionally significant residues

    • Use computational modeling to predict the impact of sequence variations on structure

  • Structural biology approaches:

    • Cryo-EM studies: Determine structures of both human and Pan troglodytes DARC in identical conditions with the same binding partners to enable direct comparison

    • HDX-MS analysis: Compare hydrogen-deuterium exchange patterns between human and chimpanzee DARC to identify differences in protein dynamics and ligand-induced conformational changes

  • Binding interface characterization:

    • Map the N-terminal regions, which serve as key interaction interfaces for chemokines

    • Compare orthosteric binding pocket architecture between species

    • Analyze the shortened TM5 and TM6 regions that prevent G-protein coupling

  • Functional structure-activity relationship studies:

    • Create chimeric constructs swapping domains between human and chimpanzee DARC

    • Perform site-directed mutagenesis of differing residues to assess functional impacts

What methodological considerations are important when studying the role of Pan troglodytes DARC in malaria infection?

When investigating Pan troglodytes DARC in malaria research, several specialized methodological considerations become critical:

  • Parasite strain selection: Choose appropriate Plasmodium vivax strains, considering the evolutionary history of human and ape P. vivax parasites. Human strains have pseudogenized RBP2d, RBP2e, and RBP3 genes, while these remain functional in ape parasites .

  • Reticulocyte enrichment optimization: Develop modified Percoll density gradient protocols specifically optimized for chimpanzee blood samples, as the search results indicate "differences in erythrocyte density between the different species" can affect enrichment efficiency .

  • Genetic diversity assessment: Consider the differences in genetic diversity patterns between human and ape P. vivax populations. Human P. vivax shows "an unusually high fraction of nonsynonymous polymorphism" with site-frequency spectra suggesting effectively neutral segregation, while ape P. vivax shows different patterns .

  • Red blood cell binding assays: When studying interactions between recombinant parasite proteins and DARC, consider that:

    • Some parasite proteins may exhibit host-specific binding patterns

    • The specificity of binding may differ between reticulocytes and mature erythrocytes

    • Multiple experimental replicates with different blood donors are necessary due to potential individual variations

  • Evolutionary context integration: Frame experimental results within the context of the "population having undergone a rapid expansion subsequent to the spread out of Africa," which may explain unusual patterns of polymorphism in human P. vivax and potentially in DARC .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.