Recombinant Pan troglodytes Epithelial membrane protein 2 (EMP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
EMP2; Epithelial membrane protein 2; EMP-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
EMP2
Target Protein Sequence
MLVLLAFIIAFHITSAALLFIATIDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST LQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRR EDIHHKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK
Uniprot No.

Target Background

Function
Epithelial membrane protein 2 (EMP2) functions as a key regulator of cell membrane composition by controlling protein surface expression. It also plays a crucial role in regulating various cellular processes, including migration, proliferation, contraction, and adhesion. EMP2 negatively regulates caveolae formation by reducing CAV1 expression and CAV1 levels through enhanced lysosomal degradation. It facilitates surface trafficking and the formation of lipid rafts containing GPI-anchor proteins. EMP2 regulates the surface expression of MHC1 and ICAM1 proteins, thereby increasing susceptibility to T-cell mediated cytotoxicity. It also regulates the plasma membrane expression of integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3, and ITGA5-ITGB1, resulting in modulation of cell-matrix adhesion. EMP2 further regulates multiple cellular processes through PTK2. It regulates blood vessel endothelial cell migration and angiogenesis by controlling VEGF protein expression through PTK2 activation. EMP2 regulates cell migration and contraction through PTK2 and SRC activation. It regulates focal adhesion density, F-actin conformation, and cell adhesion capacity through interactions with PTK2. EMP2 positively regulates cell proliferation and plays a role during cell death and cell blebbing. It promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway. EMP2 also plays a role in embryo implantation by regulating surface trafficking of the integrin heterodimer ITGA5-ITGB3. It may also play a role in glomerular filtration.
Database Links
Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane. Apical cell membrane. Membrane raft. Cytoplasm. Nucleus.

Q&A

What is the structure of EMP2 and how does it compare between humans and chimpanzees?

EMP2 is a tetraspan protein consisting of 167 amino acids in humans, with four transmembrane domains that mediate its various cellular functions . The protein contains several functional regions, including domains responsible for protein-protein interactions and membrane integration.

When comparing human and chimpanzee (Pan troglodytes) EMP2, researchers should note that while the proteins share high sequence homology due to the close evolutionary relationship between the species , the specific amino acid differences may lead to subtle functional variations in protein-protein interactions or membrane integration efficiency. Methodologically, sequence analysis using alignment tools like CLUSTAL Omega or MUSCLE is recommended for identifying conserved and variable regions between the orthologs.

What are the primary biological functions of EMP2?

EMP2 functions as a master regulator of cell membrane protein trafficking and composition, affecting multiple cellular processes:

  • Membrane organization: EMP2 facilitates surface trafficking and formation of lipid rafts bearing GPI-anchored proteins

  • Protein surface expression regulation: Controls the plasma membrane expression of integrin heterodimers (ITGA6-ITGB1, ITGA5-ITGB3, ITGA5-ITGB1)

  • Cell adhesion modulation: Regulates focal adhesion density, F-actin conformation, and cell adhesion capacity

  • Cell migration and invasion: Promotes cell migration through PTK2 and SRC activation

  • Angiogenesis: Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression

  • Immune function: Regulates surface expression of MHC1 and ICAM1, affecting T-cell mediated cytotoxicity

Research methodologies investigating these functions should employ appropriate cell-based assays, such as adhesion assays, wound healing assays for migration, tube formation assays for angiogenesis, and co-immunoprecipitation for protein interaction studies.

How does EMP2 expression vary across different tissue types?

EMP2 expression exhibits significant tissue specificity with important pathological implications:

Tissue TypeEMP2 Expression LevelResearch FindingsReference
Normal BrainLow or undetectableBaseline comparison for glioblastoma studies
Glioblastoma (GBM)High (95% of patients)Correlates with activated Src; promotes invasiveness
PlacentaHigh in normal trophoblastsEssential for proper placental angiogenesis
Breast Cancer (HER2+)Higher expressionAssociated with HER2 positivity
Breast Cancer (HER2-)Lower expressionInverse correlation with histological grade and proliferative index
Normal Breast TissueLow to moderateExpression increases from normal tissue to DCIS to invasive cancer

When designing experiments, researchers should carefully select appropriate control tissues and consider the specific pathological context to properly interpret EMP2 expression data.

What expression systems are most effective for producing recombinant Pan troglodytes EMP2?

Based on successful production of human EMP2, researchers working with Pan troglodytes EMP2 should consider:

  • Wheat germ cell-free expression system: Successfully used for human EMP2 expression , this system is advantageous for membrane proteins as it avoids toxicity issues often encountered in bacterial systems

  • Mammalian expression systems: HEK293 or CHO cells may provide proper post-translational modifications

  • Baculovirus-insect cell system: Suitable for membrane proteins requiring complex folding

When establishing an expression protocol, researchers should optimize codon usage for the selected expression system, consider adding purification tags (His, FLAG, or GST) at either N- or C-terminus (avoiding disruption of transmembrane domains), and implement rigorous quality control measures using SDS-PAGE, Western blotting, and mass spectrometry.

What purification challenges are specific to recombinant EMP2 and how can they be addressed?

As a tetraspan membrane protein, EMP2 presents several purification challenges:

  • Solubility issues: EMP2's hydrophobic transmembrane domains make it prone to aggregation. Methodology recommendation: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) during extraction and purification.

  • Maintaining native conformation: Critical for functional studies. Methodology recommendation: Employ detergent screening to identify conditions that preserve protein structure; consider nanodiscs or amphipols for detergent-free stabilization.

  • Heterogeneity: Multiple oligomeric states may occur. Methodology recommendation: Implement size exclusion chromatography as a final purification step to isolate homogeneous populations.

  • Functional validation: Essential to confirm biological activity. Methodology recommendation: Develop binding assays with known interaction partners (e.g., integrins) or cell-based functional assays appropriate to the research question.

How can researchers effectively design experiments to study EMP2's role in cell migration and invasion?

Given EMP2's established role in promoting cell migration and invasion in human GBM , researchers studying Pan troglodytes EMP2 should consider these methodological approaches:

  • Gain and loss of function models:

    • Overexpression systems using lentiviral or retroviral vectors

    • siRNA or CRISPR-Cas9 for knockdown/knockout studies

    • Comparison between human and chimpanzee EMP2 to identify species-specific effects

  • Migration assays:

    • Transwell migration assays with appropriate ECM coating

    • Wound healing assays with time-lapse microscopy

    • 3D spheroid invasion assays in matrix that better recapitulate in vivo conditions

  • Molecular pathway analysis:

    • Phosphorylation status of FAK and Src kinases, which are activated downstream of EMP2

    • Integrin expression profiling, particularly αvβ3 integrin which is upregulated by EMP2

    • Live-cell imaging to track focal adhesion dynamics using fluorescently tagged proteins

  • In vivo models:

    • Intracranial xenograft models similar to those used for human EMP2 studies

    • Comparison of invasive properties between cells expressing human versus Pan troglodytes EMP2

How should researchers approach studying EMP2's interactions with integrins and other membrane proteins?

EMP2 regulates the plasma membrane expression of several integrin heterodimers (ITGA6-ITGB1, ITGA5-ITGB3, ITGA5-ITGB1) , which influences cell-matrix adhesion. Recommended methodological approaches include:

  • Co-immunoprecipitation assays:

    • Use anti-EMP2 antibodies to pull down protein complexes

    • Western blot analysis to detect associated integrins and other binding partners

    • Compare interaction profiles between human and Pan troglodytes EMP2

  • Proximity ligation assays (PLA):

    • Detect protein-protein interactions in situ with subcellular resolution

    • Particularly valuable for membrane protein interactions that may be disrupted during cell lysis

  • FRET/BRET analysis:

    • Measure direct protein interactions in living cells

    • Requires fluorescent/bioluminescent protein fusions that maintain normal protein function

  • Surface plasmon resonance (SPR):

    • Determine binding kinetics and affinities between purified proteins

    • Requires purified recombinant proteins in functional conformations

  • Proteomics approaches:

    • Stable isotope labeling by amino acids in cell culture (SILAC) to quantify changes in the membrane proteome upon EMP2 manipulation

    • Cross-linking mass spectrometry to identify direct interaction partners

What methodologies are recommended for studying the role of EMP2 in angiogenesis?

EMP2 regulates blood vessel endothelial cell migration and angiogenesis by modulating VEGF protein expression through PTK2 activation . Studies with recombinant Pan troglodytes EMP2 should consider:

  • In vitro angiogenesis assays:

    • Endothelial tube formation assays on Matrigel

    • Endothelial cell migration and proliferation assays

    • 3D sprouting assays from endothelial spheroids

  • Molecular signaling analysis:

    • VEGF expression and secretion measurements

    • PTK2 (FAK) phosphorylation status

    • HIF-1α expression, which increases in EMP2-deficient conditions

  • Ex vivo models:

    • Aortic ring assays to assess vessel sprouting

    • Comparison between tissues exposed to human versus Pan troglodytes EMP2

  • In vivo models:

    • Matrigel plug assays with conditioned media from cells expressing recombinant EMP2

    • Developing transgenic models with regulated expression of Pan troglodytes EMP2

How can researchers reconcile contradictory findings regarding EMP2's role in different tissue contexts?

EMP2 exhibits seemingly contradictory roles across different tissues and disease states. For instance:

Tissue/Disease ContextEMP2 FunctionReference
GlioblastomaPro-tumorigenic; promotes invasion and growth
Breast Cancer (HER2+)High expression associated with HER2 status
Breast Cancer (HER2-)Low expression associated with higher grade and proliferation
Placental DevelopmentEssential for normal angiogenesis and fetal development

When confronting such contradictions, researchers should:

  • Consider tissue-specific interaction partners: Perform tissue-specific interactome studies to identify differential binding partners that may explain context-dependent functions.

  • Examine microenvironmental influences: Design experiments that account for tissue-specific extracellular matrix components, oxygen tensions, and cytokine milieus.

  • Investigate isoform-specific effects: Determine if alternative splicing or post-translational modifications differ between tissues, potentially explaining functional differences.

  • Employ systems biology approaches: Construct tissue-specific protein-protein interaction networks to predict how EMP2 functions within different cellular contexts.

  • Consider evolutionary perspectives: Compare functional differences between human and Pan troglodytes EMP2 to identify conserved versus divergent roles.

What approaches are most effective for studying EMP2's role in disease processes like cancer or placental insufficiency?

EMP2 has been implicated in both cancer progression and placental development, making it a complex target for disease-focused research . Effective methodological approaches include:

  • Integrated multi-omics analysis:

    • Combine transcriptomics, proteomics, and phosphoproteomics data

    • Identify disease-specific pathway alterations associated with EMP2 expression changes

  • Patient-derived models:

    • Use patient-derived xenografts or organoids to maintain disease heterogeneity

    • Compare EMP2 function in normal versus diseased tissues from the same patient

  • Conditional knockout models:

    • Develop tissue-specific and temporally controlled EMP2 knockout models

    • Particularly important for studying developmental roles in placentation

  • Therapeutic targeting approaches:

    • Develop and test anti-EMP2 antibodies, similar to those used in GBM models

    • Compare efficacy between antibodies targeting human versus Pan troglodytes EMP2

    • Evaluate both on-target and off-target effects across multiple tissues

  • Biomarker validation studies:

    • Correlate EMP2 expression with clinical outcomes across large patient cohorts

    • Develop standardized protocols for EMP2 detection in clinical samples

How should researchers interpret species differences when using Pan troglodytes EMP2 as a model for human EMP2 function?

When comparing Pan troglodytes and human EMP2, researchers should systematically address:

  • Sequence divergence analysis:

    • Identify amino acid differences, particularly in functional domains

    • Predict structural impacts using molecular modeling

  • Functional conservation assessment:

    • Perform side-by-side functional assays with recombinant proteins from both species

    • Quantify differences in binding affinities to conserved partners

  • Species-specific interaction networks:

    • Map and compare protein-protein interaction networks

    • Identify interaction partners that differ between species

  • Evolutionary context interpretation:

    • Consider the broader evolutionary context of observed differences

    • Determine if differences reflect adaptive changes or neutral evolution

  • Translational relevance evaluation:

    • Assess whether species differences impact the translational relevance of findings

    • Consider creating humanized models when appropriate

What quality control measures are essential when working with recombinant Pan troglodytes EMP2?

Rigorous quality control is essential for reproducible research with recombinant proteins:

  • Protein identity verification:

    • Mass spectrometry analysis to confirm amino acid sequence

    • Peptide mapping to verify complete protein coverage

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (aim for >90% purity)

    • Western blotting with specific anti-EMP2 antibodies

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy to assess secondary structure

    • Size exclusion chromatography to detect aggregation

  • Functional validation:

    • Binding assays with known interaction partners

    • Cell-based functional assays appropriate to research context

  • Lot-to-lot consistency:

    • Implement standardized quality metrics for batch release

    • Maintain detailed records of production parameters

How can researchers troubleshoot common experimental issues with recombinant EMP2?

IssuePossible CausesTroubleshooting Approach
Low expression yieldToxicity to expression host; inefficient translationTry different expression systems; optimize codon usage; use inducible promoters with tight regulation
Protein aggregationImproper folding; detergent incompatibilityScreen different detergents; optimize buffer conditions; consider fusion partners that enhance solubility
Loss of functionDenaturation during purification; improper refoldingGentler purification methods; validate structure with biophysical techniques before functional tests
Inconsistent resultsBatch variation; degradation during storageImplement strict quality control; optimize storage conditions; aliquot and avoid freeze-thaw cycles
Poor antibody recognitionEpitope masking; species-specific differencesUse multiple antibodies targeting different regions; validate antibodies with known positive/negative controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.