Recombinant Pan troglodytes G-protein coupled receptor 15 (GPR15)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Identity

GPR15, also known as "Brother of Bonzo" (BOB), is a G protein-coupled receptor (GPCR) with a conserved role in immune homeostasis and inflammation. The recombinant Pan troglodytes (chimpanzee) GPR15 is produced in E. coli and retains the full-length structure of the native receptor (1-360 amino acids) with a 10xHis-tag for purification and detection .

AttributeDetails
SourcePan troglodytes (chimpanzee)
Expression SystemE. coli in vitro system
TagN-terminal 10xHis-tag
Protein LengthFull-length (1-360 amino acids)
Molecular WeightNot explicitly stated (inferred from human ortholog: ~36.6 kDa)
SequenceMDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVL... (partial)

Receptor-Ligand Interaction Studies

  • C10ORF99 Binding: GPR15 interacts with C10ORF99, a chemokine-like ligand critical for colon-homing T cells . The recombinant protein could enable in vitro binding assays to map interaction sites.

  • Antimicrobial Activity: GPR15L (a ligand) exhibits antimicrobial properties, suggesting potential screens for GPR15’s role in innate immunity .

Signaling Pathway Analysis

  • G-Protein Coupling: Study GPR15-mediated signaling cascades (e.g., ERK1/2 activation, NF-κB modulation) .

  • Post-Translational Modifications: Investigate phosphorylation (e.g., Ser357/Ser359) or glycosylation effects on receptor trafficking .

Disease Modeling

  • Inflammatory Bowel Disease (IBD): GPR15 regulates Treg/Teff cell migration to the colon . The recombinant protein could model ligand-driven inflammation in IBD assays.

  • Cancer Immunology: GPR15+ Tregs infiltrate tumors; studying this protein may elucidate mechanisms of immunosuppression in colorectal cancer .

Evolutionary and Functional Context

GPR15-C10ORF99 pairing emerged in amniotes, correlating with herbivorous diets and colonic Treg homing . While the recombinant Pan troglodytes GPR15 is not directly implicated in evolutionary studies, its conservation highlights its utility for cross-species functional analysis.

Comparative Analysis with Human GPR15

FeaturePan troglodytes GPR15Human GPR15
Expression SystemE. coli Wheat germ, mammalian cells
Tag10xHis-tag GST, His, DDK tags
Sequence CoverageFull-length (1-360 aa) Partial (e.g., 261-360 aa in GST-tagged)
Primary ApplicationsLigand binding, signaling studies Antibody production, Western blot

Research Gaps and Future Directions

  • Structural Studies: Crystallography or cryo-EM of the recombinant protein could resolve GPR15’s active conformations.

  • Species-Specific Functions: Comparative studies with human/mouse GPR15 to identify conserved/unique signaling motifs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR15; G-protein coupled receptor 15; Brother of Bonzo; BoB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS VLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK PYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI KIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPF IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
Uniprot No.

Target Background

Function
Probable chemokine receptor. SIV-1 coreceptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR15 and what functional properties does it possess?

GPR15 is a G protein-coupled receptor encoded by the GPR15 gene. In humans and other primates, it functions primarily as a chemokine receptor and serves as an alternative coreceptor with CD4 for HIV-1 infection . Recent studies have identified its significant role in T cell trafficking, particularly to the gut, making it a promising target for inflammatory bowel disease (IBD) therapy .

The receptor possesses several biochemical functions including:

FunctionRelated Proteins
G-protein coupled receptor activityVMN1R44, OR7C1, HRH1, OLFR482, RXFP1, OPN1SW, S1PR2, GPR183B, OLFR50, OR10C1
Signal transducer activityVMN2R116, OPN1SW2, OLFR510, GPR183B, OLFR958, OLFR146, PLCH2, LITAF, FKBP1A, GPR34A

GPR15 participates in the Non-odorant GPCRs pathway alongside proteins such as CELSR1, CELSR3, OPN3, GPR132, O3far1, RRH, EMR4, and BAI2 .

What signaling pathways are associated with GPR15 activation?

GPR15 signals through multiple G protein-mediated pathways, including G i/o, G s, and G q/11 families . Experimental characterization of these signaling cascades typically employs homogenous time-resolved FRET (HTRF)-based cAMP and IP1 assays to quantify downstream effects .

Studies have demonstrated that GPR15 signaling influences nuclear factor-kappaB (NF-κB) and extracellular signal-regulated kinase (ERK) activation pathways . In pancreatic cancer research, recombinant thrombomodulin (rTM) has been shown to inhibit tumor growth by suppressing NF-κB and ERK activation through interactions with GPR15 .

For experimental assessment of GPR15 signaling, researchers commonly use:

  • BRET (Bioluminescence Resonance Energy Transfer) assays with Venus-Gβγ and masGRK3ct-Nluc constructs

  • HTRF-based second messenger assays (cAMP, IP1)

  • Pathway-specific inhibitors such as pertussis toxin (PTX) for G i/o inhibition

What are the known endogenous ligands for GPR15?

The primary endogenous ligands for GPR15 include:

  • The peptide GPR15L(25-81): This is the full-length active form of the endogenous ligand

  • C-terminal peptide fragment GPR15L(71-81): A shorter fragment that retains activation capability

Additionally, thrombomodulin (TM) has been identified as interacting with GPR15, with recombinant TM (rTM) showing anti-tumor effects in pancreatic cancer through GPR15-dependent mechanisms .

In experimental settings, these ligands are used at defined concentrations (typically 150-350 nM) to activate GPR15 and study downstream signaling events . Potency determinations for these peptides have been conducted using both HTRF-based cAMP and IP1 assays .

How is GPR15 involved in T cell trafficking to the gut?

GPR15 plays a crucial role in directing T cell migration to intestinal tissues. Research has demonstrated that:

  • GPR15 promotes integrin-dependent gut homing of T cells in vivo

  • GPR15 ligand (GPR15L) enhances T cell adhesion to MAdCAM-1 and VCAM-1, key vascular adhesion molecules expressed in gut endothelium

  • Anti-GPR15 antibodies can block this recruitment process, suggesting therapeutic potential

The mechanism involves GPR15L-induced enhancement of integrin functionality, rather than increased integrin expression levels. This promotes stronger adhesion of circulating T cells to gut vascular endothelium, facilitating their extravasation into intestinal tissues .

What experimental models are optimal for studying Pan troglodytes GPR15 function?

For investigating Pan troglodytes GPR15 function, several experimental models have proven valuable:

In vitro cellular models:

  • HEK293A cells stably expressing GPR15 receptor (selected with G418)

  • Human lymphocyte cell lines (RPMI 8866, HuT 78) for integrin binding studies

  • Primary CD4+ T cells isolated from peripheral blood for trafficking studies

Experimental approaches:

  • BRET assays to study G protein coupling, utilizing Venus-Gβγ and masGRK3ct-Nluc constructs

  • Flow cytometry for characterizing GPR15 expression on various T cell subsets

  • Dynamic adhesion assays on MAdCAM-1 or VCAM-1 substrates to assess integrin function

In vivo models:

  • Humanized mouse models to study T cell trafficking to inflamed colon tissue

  • GPR15 knockout or conditional knockout models to assess tissue-specific functions

When working with Pan troglodytes GPR15, researchers should perform careful validation to account for potential species-specific differences in ligand binding, signaling efficiency, or protein interactions.

How can researchers quantitatively measure GPR15-mediated signaling?

Robust quantification of GPR15-mediated signaling requires multiple complementary approaches:

G protein activation:

  • BRET-based assays: "BRET will happen when the Venus-Gβγ is released from the heterotrimer and subsequently interacts with the masGRK3ct-Nluc"

  • Specific G protein subtypes require optimization of transfection ratios (supporting ratios available in literature)

  • For non-G i/o family proteins (G q, G 11, G 15, G s, G 13), co-transfection with PTX-S1 DNA is recommended to suppress endogenous G i/o signals

Second messenger production:

  • HTRF-based cAMP assays for G i/o and G s pathways

  • HTRF-based IP1 assays for G q/11 pathway activation

Downstream signaling:

  • Western blotting for phosphorylated ERK and NF-κB pathway components

  • Reporter gene assays for pathway-specific transcriptional activation

Functional outcomes:

  • Flow cytometry for cell surface marker expression changes

  • Dynamic adhesion assays to measure integrin activation

  • Cell viability assays using GPR15 knockdown cells (via siRNA) to assess receptor-dependent effects

What are the methodological considerations for studying GPR15's role in disease models?

When investigating GPR15 in disease contexts, particularly inflammatory bowel disease or cancer models, several methodological considerations are critical:

For inflammatory bowel disease studies:

  • Cell isolation: CD4+ T cells should be isolated from peripheral blood and activated with anti-CD3/CD28 antibodies for 48-72 hours

  • Flow cytometry panels must include markers for T cell subsets (Th1, Th2, Th17, Treg) alongside GPR15

  • For ex vivo analysis of gut-homing T cells, isolation protocols must preserve receptor expression

  • In humanized mouse models, careful characterization of human T cell engraftment is essential

For cancer studies:

  • GPR15 expression should be validated in target cell lines (e.g., PDAC cell lines)

  • siRNA-mediated GPR15 knockdown provides crucial controls for receptor specificity

  • Both in vitro proliferation and in vivo tumor growth models should be employed

  • Downstream signaling assessment should focus on NF-κB and ERK activation

General considerations:

  • PTX treatment (100 ng/ml, 24 hours pre-experiment) is recommended to inhibit G i/o signaling when studying other G protein pathways

  • Cell line passage number should be controlled (<30) to maintain consistent receptor expression

  • For transient transfections, optimized DNA ratios are critical for reliable results

How can GPR15 be effectively targeted in experimental settings?

Several approaches have been developed to modulate GPR15 function in experimental systems:

Activation approaches:

  • Recombinant GPR15L(25-81) at 150-350 nM effectively activates the receptor

  • The C-terminal fragment GPR15L(71-81) can be used as an alternative activator

  • For studying effects on integrin-dependent adhesion, 150 nM recombinant GPR15L is recommended

Inhibition strategies:

  • Anti-GPR15 antibodies effectively block receptor function, demonstrating complete suppression of GPR15L-induced effects and even decreasing baseline activity

  • GPR15-targeting siRNA provides specific knockdown for loss-of-function studies

  • Inhibitors of downstream pathways (NF-κB, ERK) can help delineate signaling consequences

Experimental validation:

  • For antibody blocking studies, dynamic adhesion assays provide functional readouts

  • In vivo efficacy can be assessed using humanized mouse models of intestinal inflammation

  • Cell viability assays with and without GPR15 knockdown confirm receptor specificity

The combination of anti-GPR15 with standard therapies (e.g., gemcitabine in pancreatic cancer models) has shown enhanced efficacy, suggesting potential for combination therapeutic approaches .

What contradictions or limitations exist in current GPR15 research?

Several important challenges and limitations affect current GPR15 research:

Species-specific differences:

  • While Pan troglodytes GPR15 is available as a recombinant protein , most mechanistic studies utilize human GPR15

  • Potential differences in ligand binding affinity, signaling efficiency, or tissue expression patterns between species remain incompletely characterized

  • Cross-species conservation analysis is needed to validate translational relevance

Signaling complexity:

  • GPR15 signals through multiple G protein families (G i/o, G s, G q/11) , creating challenges in dissecting pathway-specific effects

  • The relative contribution of each pathway to physiological and pathological processes remains unclear

  • Context-dependent signaling (cell type, activation state, disease condition) adds further complexity

Experimental limitations:

  • Most studies rely on overexpression systems rather than endogenous receptor levels

  • Lack of highly selective small molecule modulators limits pharmacological approaches

  • The full spectrum of GPR15 ligands, including potential tissue-specific variants, remains incomplete

Therapeutic targeting challenges:

  • While anti-GPR15 antibodies show promise in blocking T cell recruitment , potential off-target effects and compensatory mechanisms require investigation

  • The balance between beneficial effects (reducing pathological inflammation) and potential adverse effects (compromising normal immune surveillance) needs careful evaluation

  • Optimal dosing, timing, and combination strategies remain to be established

Addressing these limitations will require integrated approaches combining structural biology, signaling analysis, and in vivo disease modeling to fully elucidate GPR15's complex roles in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.