Recombinant Pan troglodytes G-protein coupled receptor 56 (GPR56)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pan troglodytes GPR56

GPR56, also known as ADGRG1, belongs to the adhesion G protein-coupled receptor family, which combines both adhesion and signaling functions . These cell-surface molecules mediate intercellular communication through cell-cell and cell-matrix interactions, playing crucial roles in various biological processes . The Pan troglodytes (chimpanzee) GPR56 shares high sequence homology with its human counterpart, reflecting evolutionary conservation of this important receptor across primate species .

Sequence alignment analysis involving nine species, including Pan troglodytes, Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus, Bos taurus, Pongo abelii, Macaca mulatta, and Canis lupus familiaris, demonstrates remarkable conservation of GPR56, particularly in functionally critical regions such as transmembrane domains . This conservation underscores the fundamental importance of GPR56 in neurobiological processes including brain development, oligodendrocyte maturation, and cortical formation.

Domain Architecture and Organization

The recombinant Pan troglodytes GPR56 mirrors the domain architecture of human GPR56, consisting of a large extracellular region (ECR) coupled to a seven-transmembrane (7TM) domain typical of G protein-coupled receptors . Crystallographic studies of GPR56 ECR have revealed two distinct domains:

  1. A previously unidentified N-terminal domain now termed the Pentraxin/Laminin/neurexin/sex-hormone-binding-globulin-Like (PLL) domain

  2. A GPCR-Autoproteolysis-Inducing (GAIN) domain containing the proteolytic cleavage site

Based on human GPR56 data, the Pan troglodytes variant likely contains approximately 693 amino acids, with an estimated 377-residue extracellular domain followed by seven transmembrane regions separated by short intracellular and extracellular loops .

Post-translational Modifications and Processing

Like other adhesion GPCRs, recombinant Pan troglodytes GPR56 undergoes autoproteolytic processing at the GPCR proteolytic site (GPS) within the GAIN domain, resulting in two fragments :

  1. GPR56ᴺ: The N-terminal fragment, which undergoes extensive N-glycosylation

  2. GPR56ᶜ: The C-terminal fragment containing the 7TM region

This post-translational processing is essential for proper receptor folding, trafficking, and function . The N-terminal fragment of Pan troglodytes GPR56 likely contains a heavily glycosylated mucin-like stalk preceding the GPS, similar to human GPR56 .

Conserved Functional Residues

The glutamic acid at position 496 (E496) is conserved across all nine species examined, including Pan troglodytes, highlighting its critical role in protein structure and function . In humans, mutation of E496 to lysine (E496K) causes bilateral frontoparietal polymicrogyria (BFPP), a severe brain malformation characterized by abnormal cortical folding . This mutation affects the stability and cell surface expression of the GPR56ᶜ fragment without preventing GPS-mediated cleavage .

FeaturePan troglodytes GPR56Human GPR56Mouse GPR56
Protein Length~693 amino acids (inferred)693 amino acids687 amino acids
ECR Length~377 amino acids (inferred)377 amino acidsSimilar to human
Conserved E496PresentPresent (E496K mutation causes BFPP)Present
AutoproteolysisPresent (predicted)Present at GPSPresent at GPS
N-glycosylationPresent (predicted)Present on GPR56ᴺPresent on GPR56ᴺ

Expression Systems

While specific production methods for Pan troglodytes GPR56 are not detailed in available research, the high sequence homology suggests that techniques successful for human and mouse GPR56 would be applicable. Recommended expression systems include:

  1. Baculovirus expression system in High Five insect cells, which has been successfully used to produce properly folded and processed mouse GPR56 ECR

  2. Mammalian cell expression in HEK293T cells, employed to express full-length GPR56 and study its processing and trafficking dynamics

The recombinant protein should undergo proper folding, monomeric assembly, and autoproteolysis within the GAIN domain to be considered functional .

Purification and Quality Assessment

Based on established protocols for human recombinant GPR56, purification of Pan troglodytes GPR56 would likely involve:

  1. Affinity chromatography using terminal tags (typically His-tag or VSVG-tag)

  2. Size exclusion chromatography to ensure monomeric protein state

  3. Quality assessment via SDS-PAGE, Western blot analysis, and verification of autoproteolytic processing

For optimal stability, purified recombinant Pan troglodytes GPR56 should be:

  • Lyophilized from a 0.2 μm filtered solution in PBS

  • Reconstituted at 100 μg/mL in sterile PBS

  • Stored in a manual defrost freezer to avoid repeated freeze-thaw cycles

Ligand Interactions

Human GPR56 interacts with extracellular ligands including collagen III and tissue transglutaminase 2 (TG2), with these interactions being mediated by the N-terminal domain . Given the high sequence conservation between human and Pan troglodytes GPR56, similar ligand binding properties are anticipated for the chimpanzee variant.

Recombinant human GPR56 has demonstrated the ability to enhance cell adhesion to human fibronectin by 2-4 fold when tested in controlled cell adhesion assays . This suggests that recombinant Pan troglodytes GPR56 would likely exhibit comparable adhesion-promoting properties.

Signaling Mechanisms

As an adhesion GPCR, Pan troglodytes GPR56 presumably signals through G protein-coupled pathways, although specific G protein coupling partners have not been explicitly characterized for the chimpanzee variant. The structure of the 7TM region suggests conservation of signaling mechanisms across primate species.

Regulatory Mechanisms

Studies of human GPR56 have revealed sophisticated regulatory mechanisms that likely apply to Pan troglodytes GPR56:

  1. The PLL domain appears to have an inhibitory role, as its deletion increases basal receptor activity

  2. Mutations in the C-terminal fragment can affect receptor processing, stability, and surface expression without preventing GPS-mediated cleavage

  3. Alternative splicing can modify the ECR structure and function, as demonstrated in human GPR56 splice variant 4, which lacks the entire N-terminal domain

Developmental Neurobiology

GPR56 plays crucial roles in neural development, particularly in oligodendrocyte maturation and cortical formation . Recombinant Pan troglodytes GPR56 enables comparative studies of neurodevelopmental processes between humans and our closest evolutionary relatives.

An evolutionarily conserved residue in the PLL domain has been identified as critical for oligodendrocyte development in vivo . Investigation of this residue in Pan troglodytes GPR56 could provide insights into species-specific aspects of myelination and brain development.

Disease Modeling and Therapeutic Development

Mutations in human GPR56 cause bilateral frontoparietal polymicrogyria (BFPP), characterized by abnormal cortical lamination, mental retardation, language impairment, motor developmental delay, and seizure disorders . Comparative studies using recombinant Pan troglodytes GPR56 could elucidate:

  1. Species-specific vulnerability to GPR56 mutations

  2. Evolutionary adaptations in GPR56 signaling

  3. Potential therapeutic approaches for GPR56-related disorders

Ligand Discovery and Characterization

While collagen III and TG2 have been identified as ligands for human GPR56, comprehensive screening for Pan troglodytes GPR56-specific ligands remains an important research goal. Such studies could reveal:

  1. Species-specific ligand preferences

  2. Differential binding affinities

  3. Novel ligands unique to Pan troglodytes GPR56

Evolutionary and Comparative Studies

Comparative analysis of GPR56 across primates, with particular focus on humans and chimpanzees, could illuminate:

  1. Evolutionary pressures shaping GPR56 function

  2. The role of GPR56 in primate brain evolution

  3. Potential contributions of GPR56 variants to species-specific neurobiological traits

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADGRG1; GPR56; Adhesion G-protein coupled receptor G1; G-protein coupled receptor 56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-687
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASQSFPDPR GLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWS PQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPA SQQLQSLESKLTSVRFMGDTVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEILEY SVLLPRTLFQRTKGRRGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVDNL TEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCLCNHLTYF AVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACVVTIAAYLCSRRKPRDYTIKVHMNLLL AVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLACLSWMGLEGYNLYRLVVEVFGTY VPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSY ITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFA SGTFQLVILYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSS RI
Uniprot No.

Target Background

Function

Function: GPR56 is a G-protein coupled receptor involved in cell adhesion and likely cell-cell interactions. It mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. In the developing brain, it functions as a receptor for collagen III (COL3A1), regulating cortical development by maintaining pial basement membrane integrity and cortical lamination. COL3A1 binding inhibits neuronal migration and activates the RhoA pathway via coupling to GNA13 and potentially GNA12. GPR56 also plays a role in maintaining hematopoietic stem cells and/or leukemia stem cells within the bone marrow niche, and is essential for testis development and has been implicated in tumorigenesis.

Database Links
Protein Families
G-protein coupled receptor 2 family, LN-TM7 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.; [ADGRG1 N-terminal fragment]: Secreted.; [ADGRG1 C-terminal fragment]: Membrane raft.

Q&A

What is the domain structure of GPR56 and how does it differ from other adhesion G protein-coupled receptors?

GPR56 (also known as ADGRG1) contains two primary domains in its extracellular region (ECR): a previously unidentified N-terminal domain with a β-sandwich architecture (P28-S160) and a GPCR-Autoproteolysis-Inducing (GAIN) domain at the C-terminus (M176-S391) . The crystal structure reveals that:

  • The N-terminal domain has been termed the Pentraxin/Laminin/neurexin/sex-hormone-binding-globulin-Like (PLL) domain due to its weak homology to these protein families

  • A 15-residue linker between the two domains is ordered in the crystal structure

  • An interdomain disulfide bond links the two domains (C121 and C177), which is highly conserved among GPR56 orthologs

What are the key functional differences between recombinant Pan troglodytes GPR56 and human GPR56?

Pan troglodytes (chimpanzee) GPR56 shares high sequence homology with human GPR56, particularly within the cleaved extracellular domain (ECD). The human GPR56 sequence exhibits varying degrees of amino acid identity with different species:

SpeciesAmino Acid Identity (%) within cleaved ECD
Mouse71%
Rat72%
Canine80%
Equine80%
Bovine79%
Pan troglodytesHigh (specific percentage not provided in data)

Regarding genomic regulatory elements, the human and marmoset sequences share 92.4% identity in the 0.3 kb sequence upstream of the human e1m (which acts as a minimum promoter), while human and mouse sequences share only 62.1% identity in this region . For the critical 15-bp element involved in polymicrogyria, human and marmoset differ by two bases, while human and mouse differ by one base .

What are the recommended expression systems for producing recombinant Pan troglodytes GPR56?

Based on the literature, several expression systems have been successfully used to produce recombinant GPR56:

  • Baculovirus expression system:

    • Used for mouse GPR56 ECR purification from High Five insect cells

    • Yields folded, monomeric protein that properly undergoes autoproteolysis within the GAIN domain

  • CHO cell expression system:

    • Human recombinant GPR56 has been successfully produced in CHO cells

    • Typically yields protein with >90% purity as determined by SDS-PAGE

  • Other expression systems reported for GPR56 include:

    • E. coli

    • Yeast

    • Mammalian cells

For recombinant Pan troglodytes GPR56 specifically, the following parameters have been established:

Host/ReactivitiesPurityExpression System
Cell Free Expression≥85% purity (SDS-PAGE)Cell-free protein synthesis
E. coli/Yeast/Baculovirus/Mammalian Cell≥85% purity (SDS-PAGE)Various (for other primate GPR56 variants)

How can I verify the proper folding and autoproteolysis of recombinant GPR56?

To verify proper folding and autoproteolysis of recombinant GPR56, researchers should implement the following methodological approach:

  • SDS-PAGE analysis:

    • Run purified protein under reducing conditions

    • Visualize with silver stain

    • Properly processed GPR56 should show evidence of autoproteolysis

  • Mass spectrometry:

    • Confirm autoproteolysis has occurred

    • The GAIN domain alone is sufficient to mediate autoproteolysis

  • Analysis of electron density maps:

    • If crystal structure is available, analyze 2Fo-Fc electron density maps to confirm autoproteolysis

  • Size exclusion chromatography:

    • Verify monomeric state and appropriate molecular weight (65-85 kDa under reducing conditions)

  • Functional assays:

    • Adhesion assays: When WM-266-4 cells (10^4 cells/well) are added to plates coated with human Fibronectin (0.1 µg/mL) and rhGPR56 (10 µg/well), a 2-4 fold increase in adhesion to human fibronectin should be observed

How do expression patterns of GPR56 differ between primate species and what are the implications for research models?

GPR56 expression patterns show both similarities and differences across primate species:

  • Cerebral cortex expression:

    • In marmosets (transgenic models with human GPR56 e1m promoter), EGFP-positive cells are predominantly found in the cerebral cortex, cingulum, caudate nucleus, putamen, globus pallidus, hippocampus, hypothalamus, and cerebellum

    • GPR56 is abundantly expressed in cells of the developing cerebral cortex, including neural progenitor cells and developing neurons across primates

  • Cell-type specificity:

    • In marmosets, the human e1m promoter-driven EGFP shows preferential activity in GABAergic neurons in the developing cerebral cortex

    • Total GPR56 protein is more broadly expressed in both GABAergic and glutamatergic neurons as well as progenitor cells

    • Among EGFP-positive cells in layer V of marmoset cortex at E113, approximately 81.7% were GABA-positive and 11.6% were CTIP2-positive

    • In contrast, among pan-GPR56 positive cells, 40.3% were GABA-positive and 49.1% were CTIP2-positive

  • Neural stem/progenitor cells:

    • Only a few EGFP-positive cells were found in the inner and outer subventricular zones of the cerebral cortex in marmosets, despite high expression of endogenous GPR56 mRNA in these zones

These differential expression patterns suggest that when using recombinant Pan troglodytes GPR56 in research models, investigators should consider the potential cell-type specific effects that may not directly translate across all primate species.

What are the key functional differences in GPR56 signaling pathways across primate species?

While specific comparative signaling data across primates is limited, research suggests conserved pathways with potentially species-specific modulations:

  • RhoA pathway activation:

    • In mice, GPR56 associates with Gα12/13 family of G proteins upon binding of collagen III (a ligand)

    • This activates the RhoA pathway in radially migrating neurons, leading to controlled termination of migration

    • In zebrafish, Gpr56 promotes oligodendrocyte proliferation, with conserved functional residues in the PLL domain being critical for this function

    • Loss of Gpr56 in mice leads to decreased oligodendrocyte precursor cell proliferation and diminished levels of active RhoA

  • AKT/GSK3/EIF4 pathways:

    • GPR56 peptide agonists upregulate AKT/GSK3/EIF4 pathways, which have antidepressant-like effects

    • This appears to be conserved in human models as well, where GPR56 expression is linked to antidepressant response

  • Transcriptional coactivator signaling in NK cells:

    • In human NK cells, GPR56 ligation and downregulation are associated with transcriptional coactivator with PDZ-binding motif translocation to the nucleus and increased actin polymerization

    • This represents an inhibitory checkpoint for NK cell migration

When working with recombinant Pan troglodytes GPR56, researchers should recognize these conserved signaling mechanisms while accounting for potential species-specific differences that may affect experimental outcomes.

How can recombinant GPR56 be used to study polymicrogyria and other neurodevelopmental disorders?

Recombinant GPR56 can be applied in several experimental approaches to study polymicrogyria and related neurodevelopmental disorders:

  • Promoter activity studies:

    • Generate transgenic animal models expressing reporter genes (e.g., EGFP) driven by the human GPR56 e1m promoter

    • This approach has revealed that the e1m promoter preferentially drives expression in GABAergic neurons in the developing cerebral cortex, while total GPR56 is expressed more broadly

    • The specificity of e1m promoter activity suggests a possible role for GABAergic neurons in GPR56 mutation-associated epilepsy

  • Mutation analysis:

    • Introduce specific mutations associated with bilateral frontoparietal polymicrogyria (BFPP) into recombinant GPR56

    • Two BFPP mutations mapped to the GAIN domain (C346S and W349S) eliminate a conserved disulfide bond and mutate a conserved hydrophobic core residue, respectively

    • These mutations cause global folding problems of the GAIN domain and reduce autoproteolysis

  • Binding partner identification:

    • Use recombinant GPR56 extracellular domain fused to tags (such as Fc fragment) as probes to identify binding partners in brain tissue

    • This approach has identified tissue transglutaminase (TG2) as a binding partner of GPR56

  • Neuronal migration and cortical development studies:

    • Employ recombinant GPR56 in combination with collagen III to study Gα12/13 and RhoA pathway activation in migrating neurons

    • GPR56-mediated signaling controls termination of neuronal migration, critical for proper cortical development

What methodological approaches can be used to study the role of GPR56 in oligodendrocyte development and myelination?

Several methodological approaches can be employed to investigate GPR56's role in oligodendrocyte development and myelination:

  • Animal models with modified GPR56 expression:

    • Constitutive knockout models: Gpr56-deficient mice exhibit disorganized cortical lamination and cobblestone-like malformations

    • Conditional/inducible knockout models: Cell-type specific deletion of Gpr56 in oligodendrocyte precursor cells (OPCs) leads to reduced numbers of mature oligodendrocytes, similar to constitutive knockout

    • Zebrafish model: Loss of Gpr56 results in reduced numbers of mature oligodendrocytes and myelinated axons

  • Molecular expression analysis:

    • Assess expression of myelin basic protein (mbp) as a readout for GPR56 activity in zebrafish

    • Transient expression of mouse GPR56 mRNA increases mbp expression above wild-type levels

  • Site-directed mutagenesis:

    • Test specific point mutations in the conserved patch of the PLL domain (e.g., H89A, S150A, H381S, C121S+C177S)

    • Injection of mRNA encoding mouse GPR56 H89A mutant failed to enhance mbp expression in zebrafish, identifying this residue as critical for oligodendrocyte development

  • Recombinant protein studies:

    • Use recombinant GPR56 to investigate binding partners specific to oligodendrocyte development

    • Apply these proteins in cell culture systems to examine effects on oligodendrocyte proliferation and differentiation

How can recombinant GPR56 be utilized to develop potential therapeutics for depression?

Recent discoveries about GPR56's role in depression and antidepressant response open several avenues for therapeutic development:

  • High-throughput screening for GPR56 modulators:

    • Use recombinant Pan troglodytes GPR56 (which shares high homology with human GPR56) in binding assays to identify novel agonists or positive allosteric modulators

    • Test compounds for their ability to upregulate AKT/GSK3/EIF4 pathways, which have been associated with antidepressant-like effects

  • Development of GPR56 peptide agonists:

    • Two peptide agonists have already shown antidepressant-like effects in mouse models

    • Recombinant GPR56 can be used to optimize these peptides for improved binding affinity and pharmacokinetic properties

  • Biomarker development:

    • GPR56 mRNA levels in blood increase in parallel with antidepressant response in humans

    • Develop assays using recombinant GPR56 to monitor patient response to treatment

    • In three cohorts of individuals with depression treated with serotonin-norepinephrine reuptake inhibitors (N=424), responders displayed an increase in GPR56 mRNA in blood, while non-responders did not

  • Target validation studies:

    • In mouse prefrontal cortex (PFC), Gpr56 knockdown is associated with:

      • Depressive-like behaviors

      • Executive dysfunction

      • Poor response to antidepressant treatment

    • Conversely, PFC-specific Gpr56 overexpression in naïve mice induces decreased immobility in behavioral tests, mimicking antidepressant effects

What are the most advanced techniques for studying GPR56-ligand interactions?

Several sophisticated techniques can be employed to study interactions between recombinant GPR56 and its ligands:

  • X-ray crystallography:

    • The crystal structure of GPR56 ECR has been determined in complex with an inverse-agonist monobody

    • This approach revealed critical details about the receptor's domain organization and ligand binding interfaces

    • Data collection parameters for successful crystallization:

      ParameterNativeSe-Met
      Wavelength (Å)1.00000.9794
      Resolution (Å)40.0-3.3 (3.42-3.30)40.0-3.9 (4.04-3.90)
      Space groupP3121P3121
      R-merge0.089 (0.617)0.131 (0.637)
      I/σI13.5 (2.2)11.7 (2.3)
      Completeness (%)99.9 (100.0)99.9 (100.0)
      Redundancy5.7 (5.7)11.2 (10.9)
  • Engineered protein binding partners (monobodies):

    • Monobodies with high affinity for GPR56 ECR can be identified through combinatorial phage-display libraries and yeast surface display

    • The clone with highest affinity, Mb(mGPR56_α5), had an apparent dissociation constant in the nanomolar range

  • Biochemical purification and mass spectrometry:

    • Fusion proteins containing GPR56 N-terminus fused to IgG Fc fragment can be used as probes for ligand identification

    • This approach identified tissue transglutaminase (TG2) as a binding partner of GPR56

    • The C-terminal β-barrel domains of TG2 were found necessary for binding to GPR56

  • Ligand characterization using deletion mutants:

    • Deletion of the PLL domain in GPR56 caused increased signaling, identifying this domain as a key regulatory element

    • This technique helped characterize a naturally occurring GPR56 splice variant

How can recombinant GPR56 be applied in cancer research, particularly in understanding melanoma metastasis?

Recombinant GPR56 offers several approaches for investigating its role in cancer biology:

  • Expression profiling and correlation with metastatic potential:

    • GPR56 is down-regulated in highly metastatic variants compared to poorly metastatic melanoma cell lines

    • Overexpression of GPR56 suppresses tumor growth and metastasis, while reduced expression enhances tumor progression

    • These effects are not cell-autonomous, as cells with altered GPR56 levels grow at similar rates in vitro

  • Interaction studies with tumor microenvironment components:

    • Use recombinant GPR56 to study interactions with tissue transglutaminase (TG2), a widespread component of tissue and tumor stroma

    • GPR56-TG2 interactions may mediate suppression of tumor growth and metastasis

    • Biochemical studies revealed that the extracellular portion of GPR56 binds to TG2, an extracellular matrix protein ubiquitously expressed in tissues

  • Domain-specific functional analysis:

    • When the C-terminal β-barrel domains of TG2 were deleted, ability to bind GPR56 was lost

    • This indicates that specific domains are necessary for the interaction between GPR56 and its binding partners in the tumor microenvironment

  • Transgenic models and in vivo imaging:

    • Use recombinant Pan troglodytes GPR56 (which shares high structural similarity with human GPR56) in radioligand binding studies to trace receptor distribution in tumors

    • Develop imaging tools to monitor GPR56 expression levels in vivo during tumor progression and metastasis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.