Recombinant Pan troglodytes Histamine H2 receptor (HRH2)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant HRH2 Variants for Pan troglodytes

Product CodeExpression SystemTagPurityApplication
CSB-CF010738EQVE. coliHis-tag≥85%Binding assays, drug screening
CSB-EP010738EQV1Mammalian cellsNone≥90%Functional studies

Production and Expression Systems

Recombinant HRH2 is produced using diverse platforms to suit experimental needs:

  • Prokaryotic Systems: E. coli offers high yield but may lack post-translational modifications .

  • Eukaryotic Systems: Insect or mammalian cells (e.g., HEK293, CHO-K1) enable proper folding and glycosylation, critical for ligand-binding studies .

Key Protocols:

  • Thawing/Subculturing: Cells are maintained in Ham’s F12 medium with Zeocin (200 µg/ml) and Hygromycin B (100 µg/ml) .

  • Calcium Signaling Assays: Histamine induces dose-dependent cAMP production (EC₅₀ = 15 nM in CHO-K1/H2/Gα15 cells) .

Functional Characteristics

HRH2 activates Gs-protein-coupled pathways, leading to:

  • cAMP Production: Drives gastric acid secretion and modulates cardiac contractility .

  • Cross-Talk with H1R: Heterodimerization with histamine H1 receptors alters downstream signaling (e.g., reduced IP₃ and cAMP responses) .

Table 2: HRH2 Signaling Pathways

PathwayKey Proteins InvolvedFunctional Role
cAMP-PKAAdenylate cyclase, PKAGastric acid secretion
PhosphoinositidePLC, IP₃Cell growth/differentiation

Drug Discovery

  • Antagonist Screening: Cimetidine and aminopotentidine show high affinity for HRH2, validated via competitive binding assays .

  • Desensitization Studies: Prolonged histamine exposure reduces receptor responsiveness, mimicking clinical drug tolerance .

Disease Modeling

  • Gastrointestinal Disorders: HRH2 overexpression correlates with peptic ulcers and gastroesophageal reflux disease (GERD) .

  • Cardiovascular Effects: HRH2-mediated cAMP elevation in cardiomyocytes links histamine to arrhythmias and heart failure .

Comparative Insights

  • Cross-Species Reactivity: Antibodies against chimpanzee HRH2 (e.g., CSB-PA009281) cross-react with human and rodent variants, enabling translational research .

  • Structural Mutations: Mutagenesis studies highlight transmembrane domains 3 and 5 as critical for ligand binding .

Challenges and Innovations

  • Expression Yield: Eukaryotic systems improve functionality but require optimization to reduce costs .

  • Apoptosis Link: HRH2 activation upregulates pro-apoptotic Bax and caspase-3 in fibroblasts, suggesting roles in cancer therapy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. It also appears to regulate gastrointestinal motility and intestinal secretion. It may play a role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins, which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Histamine H2 receptor and what signaling pathways does it activate?

The histamine H2 receptor (HRH2) belongs to the family 1 of G protein-coupled receptors and functions as an integral membrane protein . It primarily couples to Gs-proteins to activate adenylyl cyclase, leading to increased intracellular cAMP levels . This signaling cascade distinguishes it functionally from other histamine receptor subtypes (H1, H3, and H4), which utilize different G-protein coupling mechanisms. The receptor is expressed in numerous cell types throughout the body and plays key roles in physiological processes including gastric acid secretion, gastrointestinal motility regulation, and potentially cell growth and differentiation .

Methodologically, researchers can detect HRH2-mediated signaling by measuring adenylyl cyclase activity in response to histamine or selective H2 agonists. This activation occurs in a dose-dependent manner, with histamine showing effectiveness from concentrations of 0.1 μM to 1 mM in experimental models . For experimental validation of receptor specificity, it's important to note that histamine H1-receptor antagonists (like mepyramine) and beta-adrenoceptor antagonists (like propranolol) do not affect histamine stimulation of adenylyl cyclase mediated by H2 receptors .

How do Pan troglodytes HRH2 expression systems compare to other mammalian models?

While the search results don't specifically address Pan troglodytes (chimpanzee) HRH2 expression systems, we can extrapolate from established methodologies for other mammalian HRH2 proteins. Recombinant expression systems frequently utilize Sf9 insect cells infected with HRH2-encoding baculovirus, as demonstrated with canine HRH2 . This system allows the receptor to couple to insect cell Gs-proteins, enabling detection of histamine-stimulated adenylyl cyclase activity.

For functional studies of mammalian HRH2, researchers should consider that:

  • Recombinant tagging strategies commonly include N-terminal FLAG tags and C-terminal hexahistidine (His6) tags, which facilitate immunological detection, purification, and provide protection against proteolysis

  • The molecular mass of tagged mammalian HRH2 is approximately 60 kDa

  • Proper storage conditions are critical (-80°C, avoiding freeze/thaw cycles) to maintain receptor functionality

When designing Pan troglodytes HRH2 expression experiments, researchers should consider the potential for species-specific differences in post-translational modifications, binding affinities, and signaling efficacy compared to the more commonly studied human, canine, or rodent variants.

What are the key experimental controls when working with recombinant HRH2?

When conducting research with recombinant Pan troglodytes HRH2, implementing proper controls is essential for experimental validity. Based on established protocols for histamine receptor research, researchers should include:

  • Pharmacological controls: Include selective H2 receptor antagonists in parallel experiments to confirm specificity of observed effects. In adenylyl cyclase activity assays, H2-antagonists shift the dose-response curve for histamine to the right in a dose-dependent manner . Constructing Schild plots for these antagonists should produce straight lines with slopes not significantly different from unity if the effects are specifically mediated through HRH2 .

  • Cross-receptor controls: Include H1-receptor antagonists like mepyramine (10 μM) to rule out H1-mediated effects, and beta-adrenoceptor antagonists like propranolol (10 μM) to eliminate potential confounding by other G-protein coupled receptors .

  • Expression validation: Verify proper expression and localization of recombinant HRH2 using techniques like Western blotting with validated anti-HRH2 antibodies. When using antibody-based detection methods, researchers should be aware that the observed molecular weight of HRH2 (approximately 111 kDa) may differ from calculated weights (around 40 kDa) due to post-translational modifications and experimental conditions .

How do different tagging strategies affect HRH2 functionality?

The choice of tagging strategy significantly impacts recombinant HRH2 functionality and experimental applications. Based on established methodologies:

  • FLAG/His dual tagging: A common approach involves N-terminal FLAG tags combined with C-terminal hexahistidine (His6) tags . This configuration offers multiple advantages:

    • Enables immunological detection via two distinct epitopes

    • Facilitates purification through nickel affinity chromatography

    • Provides protection against proteolysis at vulnerable termini

    • Maintains receptor functionality in adenylyl cyclase coupling assays

  • Tag positioning considerations: When designing constructs for Pan troglodytes HRH2, researchers should consider that:

    • N-terminal modifications may affect ligand binding characteristics

    • C-terminal modifications might impact G-protein coupling efficiency

    • Multiple studies indicate C-terminal regions of HRH2 are particularly important for signal transduction, as C-terminally truncated variants show altered cAMP generation compared to wild-type receptors

  • Validation protocols: Regardless of tagging strategy, researchers should:

    • Compare adenylyl cyclase activation profiles between tagged and untagged receptor variants

    • Assess receptor desensitization patterns, as G-protein coupled receptor kinases 2 and 3 (GRK2 and GRK3) can lead to desensitization of HRH2 following histamine exposure

    • Verify subcellular localization is not compromised by tagging

What methodologies are most effective for studying HRH2-mediated cellular signaling?

Investigating HRH2-mediated signaling requires complementary methodologies targeting different aspects of receptor function:

  • Adenylyl cyclase activity assays: This primary assay for HRH2 functionality measures cAMP production following receptor activation. Effective protocols include:

    • Using dose ranges of histamine (0.1 μM to 1 mM) or selective H2 agonists like dimaprit (1 μM to 10 mM), 4-methyl histamine (0.1 μM to 10 mM), or impromidine (10 nM to 10 μM)

    • Including forskolin (1 nM to 100 μM) as a positive control for adenylyl cyclase stimulation

    • Constructing complete dose-response curves and analyzing EC50 values

  • Signal transduction pathway analysis: HRH2 activation can trigger multiple downstream effects beyond cAMP, including:

    • Calcineurin (protein phosphatase 2B) expression changes, which can be monitored via Western blotting

    • Nuclear translocation of nuclear factor of activated T-cells c3 (NFATc3), assessable through nuclear fraction isolation and immunoblotting

    • Expression changes in α-smooth muscle actin (αSMA), detected via immunoblotting or qRT-PCR

  • Apoptosis pathway assessment: For studying HRH2 roles in cell survival:

    • Monitor caspase 3 activation through activity assays or Western blotting

    • Assess Bax translocation to mitochondria through subcellular fractionation and immunoblotting

    • Use flow cytometry with Annexin V/PI staining to quantify apoptotic cell populations

These methodologies should be adapted according to the specific cell type or tissue being studied, as HRH2 signaling can vary significantly between different biological contexts.

How does brain distribution of HRH2 inform functional studies?

The neuroanatomical distribution of HRH2 provides critical insights for designing targeted functional studies. Based on comprehensive mapping in primates:

  • Regional expression patterns: HRH2 mRNA shows highest expression in:

    • Caudate and putamen nuclei

    • External layers of cerebral cortex

    • Moderate levels in hippocampal formation

    • Lower densities in dentate nucleus of cerebellum

  • Notable absence of expression in:

    • Globus pallidus

    • Amygdaloid complex

    • Cerebellar cortex

    • Substantia nigra

  • Correlation with binding sites: The distribution of HRH2 mRNA generally corresponds well with receptor binding sites, with highest density in:

    • Caudate

    • Putamen

    • Accumbens nuclei

    • Cortical areas

This distribution pattern has significant implications for functional studies:

  • Cell-specific expression: The presence of mRNA in caudate and putamen, coupled with absence in substantia nigra, suggests HRH2 receptors in the striatum are synthesized by intrinsic cells rather than by nigral dopaminergic neurons

  • Circuit implications: Striatal HRH2 receptors may be located on:

    • Short-circuit striatal interneurons

    • Somatodendritic regions of striatal projection neurons targeting the globus pallidus pars lateralis

Researchers studying Pan troglodytes HRH2 should consider these distribution patterns when designing functional experiments, particularly when investigating neuropharmacological applications or neuropsychiatric disease models.

How do mutations in HRH2 affect receptor functionality and signaling?

Mutations in HRH2 can profoundly impact receptor function, with specific effects dependent on the location and nature of the amino acid substitution:

  • C-terminal mutations:

    • C-terminally truncated variants of HRH2 generate more cAMP compared to wild-type receptors when expressed in transfected cells, representing a potential gain-of-function mutation

    • This region appears particularly important for regulation of signal transduction efficiency

  • Desensitization mechanisms:

    • Mutations affecting phosphorylation sites can alter receptor desensitization patterns

    • G-protein coupled receptor kinases 2 and 3 (GRK2 and GRK3) mediate desensitization of HRH2 following histamine exposure in COS-7 cells

    • Phosphorylation-resistant mutants may show prolonged signaling responses

  • Ligand binding domain alterations:

    • Mutations in the histamine binding pocket can modify:

      • Ligand affinity (higher or lower EC50 values)

      • Ligand selectivity profiles

      • Efficacy of signal transduction

    • These have been extensively studied to define critical residues for ligand recognition

Experimental approaches for studying Pan troglodytes HRH2 mutations should include:

  • Site-directed mutagenesis to introduce specific amino acid substitutions

  • Expression in appropriate cell systems (Sf9 insect cells or mammalian cell lines)

  • Comparative pharmacological profiling using radioligand binding assays

  • Functional analysis through adenylyl cyclase activity measurements

  • Assessment of receptor desensitization kinetics

  • Evaluation of downstream signaling pathway activation

The translation of findings from in vitro mutation studies to physiological relevance requires careful consideration, as demonstrated by the observation that while mice express HRH2 mRNA and protein in cardiac tissue, they lack functional histamine-induced inotropic or chronotropic effects .

What approaches can reveal HRH2's role in cellular apoptosis and proliferation?

HRH2 signaling has been implicated in regulating both apoptosis and proliferation, with potentially tissue-specific effects. To investigate these roles in Pan troglodytes HRH2, researchers can employ several methodological approaches:

  • Apoptosis pathway analysis:

    • Caspase cascade activation: Monitor pro-apoptotic caspase 3 levels and activity following HRH2 stimulation, as demonstrated in neonatal rat cardiomyocytes

    • Mitochondrial pathway: Assess Bax protein expression and its translocation to mitochondria following histamine exposure (24h treatment has shown increases in neonatal rat cardiomyocytes)

    • Comparative receptor analysis: Include selective agonists/antagonists for different histamine receptor subtypes to determine which receptor mediates observed effects

  • Proliferation assessment:

    • Calcineurin signaling: Monitor protein expression of calcineurin (protein phosphatase 2B), as HRH2-mediated increases have been linked to proliferation in neonatal rat fibroblasts

    • Nuclear translocation: Track NFATc3 (nuclear factor of activated T-cells c3) movement to the nuclear fraction following HRH2 stimulation

    • Cytoskeletal markers: Measure α-smooth muscle actin (αSMA) expression as an indicator of myofibroblast differentiation and proliferative status

  • Tissue-specific considerations:

    • Cardiac models: In cardiac tissue, HRH2 activation can trigger release of atrial natriuretic peptide(s) (ANP), which serves as both a functional readout and a potential modulator of apoptotic/proliferative balance

    • Signaling context: Effects may differ between cardiomyocytes and cardiac fibroblasts, necessitating cell-type specific analysis

  • Experimental validation:

    • Include appropriate time course studies (acute vs. chronic exposure)

    • Utilize both pharmacological (agonists/antagonists) and genetic approaches (siRNA, CRISPR-Cas9) to manipulate HRH2 function

    • Confirm specificity through rescue experiments

Given that most research on HRH2-mediated apoptosis has been conducted in neonatal rat models, examining these pathways in adult tissues and across species (particularly in Pan troglodytes) represents an important research frontier .

How can researchers effectively address species differences in HRH2 pharmacology?

Species-specific variations in HRH2 structure and function present significant challenges for translational research. Researchers working with Pan troglodytes HRH2 should implement rigorous comparative approaches:

  • Comparative binding studies:

    • Determine affinity constants for histamine and selective agonists across species

    • Note that histamine has variable affinity across histamine receptor subtypes, with lower affinity for H2 compared to H1, H3, and H4 receptors

    • Use complementary techniques (radioligand binding, functional assays) to generate comprehensive pharmacological profiles

  • Functional expression systems:

    • Express recombinant Pan troglodytes HRH2 alongside human, mouse, or rat variants in the same cellular background

    • Standardize expression levels through quantitative Western blotting or flow cytometry

    • Compare signaling responses using identical experimental conditions

    • Construct full dose-response curves rather than testing single concentrations

  • Structural considerations:

    • Analyze sequence homology between Pan troglodytes HRH2 and other species

    • Focus particularly on transmembrane domains and ligand binding pockets

    • Consider computational modeling to predict functional differences based on amino acid substitutions

  • Tissue-specific pharmacology:

    • Be aware that some species show tissue-specific HRH2 functionality differences

    • For example, mouse hearts express HRH2 mRNA and protein but lack functional histamine-induced inotropic or chronotropic effects, unlike human cardiac tissue

    • This suggests complex post-translational or regulatory mechanisms beyond simple receptor expression

The table below summarizes key methodological considerations for cross-species HRH2 pharmacology studies:

MethodologyKey ParametersSpecies Considerations
Binding assaysKd, Bmax, competition profilesUse consistent protocols across species
Signaling assaysEC50, Emax, time courseControl for expression level differences
Antagonist studiespA2 values, Schild regressionTest multiple antagonist structural classes
Cell backgroundEndogenous G-protein levelsUse same host cells for cross-species comparison
Trafficking analysisSurface expression, internalization ratesMay vary independently of binding properties

Through systematic comparative analyses, researchers can identify crucial species differences that may impact the translational relevance of findings from Pan troglodytes HRH2 studies to human applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.