Recombinant Pan troglodytes Integral membrane protein 2B (ITM2B)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pan troglodytes ITM2B

ITM2B (BRI2) is a type II transmembrane protein implicated in amyloid precursor protein (APP) processing and neuroprotection. The recombinant form replicates the native protein’s structure and function for in vitro studies, enabling mechanistic insights into neurodegenerative diseases like Alzheimer’s .

Production and Purification

Recombinant ITM2B is generated using multiple platforms:

Table 1: Expression Systems for Recombinant ITM2B

SystemAdvantagesLimitations
HEK293 cellsNative glycosylation and foldingHigh cost, low yield
E. coliRapid production, low costLacks post-translational modifications
Wheat GermCell-free, scalableLimited to soluble domains

Source: Creative BioMart

Role in Amyloid Regulation

  • Inhibits β-secretase cleavage of APP, reducing Aβ40/42 production .

  • Loss of ITM2B increases Aβ levels in murine models .

Interaction with TREM2

  • ITM2B binds TREM2 ectodomains, modulating microglial activity and synaptic pruning .

  • Itm2b-KO mice exhibit elevated Trem2-CTF (C-terminal fragment) and dysregulated cytokine secretion .

Table 2: Phenotypic Effects of ITM2B Deficiency

Observation in Itm2b-KO ModelsMechanism
Increased Aβ40/42 levelsLoss of APP cleavage inhibition
Altered microglial clustersDysregulated Trem2 processing
Synaptic deficitsReduced BRI2ICD nuclear translocation

Sources:

Applications in Research

  • Amyloid Pathology Studies: Used to dissect ITM2B’s role in Aβ inhibition .

  • Microglial Signaling: Investigates ITM2B-TREM2 interactions in neuroinflammation .

  • Therapeutic Development: Screens compounds targeting BRICHOS domain for anti-aggregation effects .

Comparative Analysis with Human ITM2B

FeaturePan troglodytes ITM2BHuman ITM2B
Amino Acid Identity>98%Reference standard
Disease MutationsNot reportedFBD (X267R), FDD (795-796ins)
BRICHOS DomainConserved structure/functionIdentical functional role

Sources:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ITM2B; Integral membrane protein 2B; Immature BRI2; imBRI2; Transmembrane protein BRI; Bri
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
ITM2B
Target Protein Sequence
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
Uniprot No.

Target Background

Function
ITM2B plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of amyloid-beta peptide aggregation and fibrils deposition. It contributes to the induction of neurite outgrowth. ITM2B functions as a protease inhibitor by blocking access of secretases to APP cleavage sites. Mature BRI2 (mBRI2) functions as a modulator of APP processing, leading to a significant reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42. Bri23 peptide prevents the aggregation of APP amyloid-beta protein 42 into toxic oligomers.
Database Links

KEGG: ptr:452714

STRING: 9598.ENSPTRP00000009973

UniGene: Ptr.742

Protein Families
ITM2 family
Subcellular Location
[Integral membrane protein 2B]: Golgi apparatus membrane; Single-pass type II membrane protein.; [BRI2, membrane form]: Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.; [Bri23 peptide]: Secreted.; [BRI2C, soluble form]: Secreted.

Q&A

What is Pan troglodytes Integral Membrane Protein 2B (ITM2B)?

Pan troglodytes Integral Membrane Protein 2B (ITM2B), also known as BRI2 in chimpanzees, is a type II transmembrane protein ubiquitously expressed across tissues. Similar to its human ortholog, chimpanzee ITM2B likely contains a transmembrane domain with its N-terminus in the cytoplasm and its C-terminus in the extracellular/luminal space. The protein undergoes regulated intramembrane proteolysis (RIP), a process that generates various protein fragments with potentially distinct biological functions. While the physiological function of ITM2B remains poorly understood, recent advances have identified potential roles in apoptosis and tumor suppression, as well as in processing the amyloid precursor protein (APP) .

What is the protein structure and processing of ITM2B?

ITM2B is a type II transmembrane protein that undergoes regulated intramembrane proteolysis (RIP). This processing involves an initial ectodomain shedding followed by an intramembrane cleavage, a mechanism mainly involved in cellular signaling events and membrane-retained fragment degradation . Specifically, ITM2B undergoes RIP at the cis- or medial-Golgi and cell membrane, resulting in the formation of several secreted peptides. The processing begins with ectodomain shedding by proteases such as ADAM10, generating a membrane-bound N-terminal fragment (NTF). This NTF is further subjected to intramembrane proteolysis by signal peptide peptidase-like proteases (SPPL2a/b) to release the ITM2B intracellular domain (BRI2ICD) . Protein phosphorylation has been identified as a key regulatory mechanism that modulates this processing, with phosphorylated ITM2B showing increased processing by ADAM10 .

What neurodegenerative conditions are associated with ITM2B?

ITM2B has been implicated in several neurodegenerative diseases, making it an important target for therapeutic development. The protein has been associated with Familial British Dementia (FBD), Familial Danish Dementia (FDD), Alzheimer's Disease, ITM2B-related retinal dystrophy, and multiple sclerosis . The two major dementia types—Familial British and Danish dementias—are caused by specific mutations in the ITM2B gene. The British type results from a mutation (Ter267Arg or X267R) that changes the stop signal, resulting in a protein that is longer than normal. The Danish type involves a similar mutation mechanism . These mutations lead to the production of distinct 34 amino acid long peptides called ABri and ADan, respectively, which are deposited as amyloid fibrils . Understanding these disease mechanisms in the context of chimpanzee ITM2B could provide evolutionary insights into human-specific vulnerability to these conditions.

How does ITM2B interact with the amyloid precursor protein?

ITM2B plays a significant role in processing the amyloid precursor protein (APP), which is produced by the APP gene and implicated in Alzheimer's disease pathology. While the complete function of APP remains incompletely understood, it is thought to be involved in nerve cell function in the brain during early development . Research suggests that ITM2B is involved in preventing (inhibiting) certain forms of the amyloid precursor protein from accumulating in the body's cells and tissues . This inhibitory function positions ITM2B as a potential therapeutic target for Alzheimer's disease, as modulating its activity could potentially influence amyloid accumulation. Studies with recombinant Pan troglodytes ITM2B could help determine whether this APP processing regulation is conserved across primates and whether species-specific differences exist in this critical interaction.

What are the known interacting partners of ITM2B?

Quantitative mass spectrometry-based proteomics has identified numerous ITM2B partners in human tissues. In the human retina, for example, 457 potential ITM2B interactors have been identified . Gene ontology analysis of these interactors revealed associations with several cellular components and biological processes, including:

  • Organelle inner membrane components

  • Mitochondrial inner membrane and respiratory complexes

  • Oxidative phosphorylation pathways

  • Respiratory electron transport chain components

  • Mitochondrial ATP synthesis coupled electron transport

Additionally, a network of 140 common interactors identified with different antibodies showed associations with cytoskeletal components, including supramolecular fiber, polymeric cytoskeletal fiber, and microtubule structures . These findings suggest that ITM2B may have roles in both mitochondrial function and cytoskeletal organization, potentially influencing cellular energy metabolism and structural integrity.

What expression systems are optimal for producing recombinant Pan troglodytes ITM2B?

The choice of expression system for recombinant Pan troglodytes ITM2B depends on research objectives and required protein characteristics. For most functional studies, mammalian expression systems (HEK293, CHO cells) are preferred as they provide the most authentic post-translational modifications and proteolytic processing. These systems are essential when studying intact ITM2B with proper glycosylation and phosphorylation patterns, which are known to regulate ITM2B processing . For structural studies requiring higher protein yields, insect cell systems (Sf9, High Five) offer a compromise between proper folding and production quantity. Bacterial systems like E. coli are generally not recommended for full-length ITM2B due to its transmembrane domain and complex post-translational modifications, but may be useful for producing soluble domains or fragments for specific applications .

What purification strategies work best for recombinant ITM2B?

Purifying transmembrane proteins like ITM2B presents significant challenges requiring specialized approaches. An effective purification strategy typically includes affinity tags (His6, FLAG, or Strep-tag) positioned to avoid interference with protein function, allowing for single-step affinity purification. Detergent selection is critical for extracting ITM2B from membranes while preserving native structure, with mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (CHAPS) commonly used. Multiple chromatography techniques may be required, including immobilized metal affinity chromatography for His-tagged constructs, size exclusion chromatography to separate monomeric protein from aggregates, and ion exchange chromatography as an additional purification step . For functional studies, reconstituting purified ITM2B into nanodiscs or amphipols can provide a more native-like membrane environment. Each purification batch should be characterized for purity and structural integrity using techniques such as SDS-PAGE, Western blotting, and circular dichroism.

How can researchers verify proper folding and functionality of recombinant ITM2B?

Verifying proper folding and functionality of recombinant Pan troglodytes ITM2B requires multiple complementary approaches:

Verification MethodApplicationKey Parameters
Circular dichroismSecondary structure assessmentAlpha-helical content matching predicted structure
Thermal stability assaysProtein folding qualityMelting temperature (Tm) comparison with native protein
Limited proteolysisStructural integrityResistance pattern to proteases
APP processing inhibitionFunctional verificationQuantitative measurement of APP processing products
Interactome analysisBinding partner verificationCo-immunoprecipitation with known partners
Phosphorylation statusPost-translational modificationMass spectrometry-based phosphosite mapping

These methods collectively provide confirmation that the recombinant protein maintains native-like structure and function. Particularly important is verifying that the recombinant ITM2B undergoes proper regulated intramembrane proteolysis, which is central to its biological function . Co-expression with relevant proteases or using cell lines with appropriate processing machinery may be necessary to reproduce the native proteolytic pattern.

How can researchers effectively study the ITM2B interactome?

Investigating the ITM2B interactome requires sophisticated methodologies that capture both stable and transient interactions. Immunoprecipitation coupled with mass spectrometry (IP-MS) has been successfully employed in human retina studies, using antibodies targeting different epitopes of ITM2B to comprehensively identify interacting partners . In one approach, antibodies binding to the N-terminal 1-54 amino acid region and the 15-264 amino acid region of ITM2B were used, identifying 254 and 360 proteins respectively, with 140 common interactors between both approaches . This strategy can be adapted for Pan troglodytes ITM2B studies.

For more comprehensive interactome mapping, proximity labeling approaches such as BioID or APEX2 can identify proteins in close proximity to ITM2B in living cells. Cross-linking mass spectrometry (XL-MS) can capture transient interactions and provide structural information about interaction interfaces. The mitochondrial associations revealed in human ITM2B interactome studies suggest particular attention should be paid to mitochondrial purification techniques when studying chimpanzee ITM2B . Comparative interactomics between human and chimpanzee cells can identify conserved and divergent interaction networks, potentially illuminating species-specific functions.

What approaches are effective for studying ITM2B phosphorylation?

Protein phosphorylation has been identified as a key regulatory mechanism for ITM2B processing, with phosphorylated ITM2B showing increased processing by ADAM10 . Studying this regulation requires specialized approaches:

  • Phosphorylation site mapping using mass spectrometry-based phosphoproteomics to identify specific modified residues

  • Comparison between basal and stimulated conditions to identify regulated sites

  • Site-directed mutagenesis of putative phosphorylation sites (Ser/Thr/Tyr to Ala or Asp/Glu)

  • Phosphomimetic mutations (Ser/Thr to Asp/Glu) to simulate constitutive phosphorylation

  • Quantitative analysis of processing efficiency using pulse-chase experiments

  • Kinase inhibitor screens to identify regulatory pathways

  • Analysis under conditions relevant to neurodegeneration (oxidative stress, amyloid exposure)

These approaches can reveal how phosphorylation serves as a regulatory switch for ITM2B function, potentially illuminating therapeutic opportunities for modulating its activity in disease contexts.

How can researchers study ITM2B's role in mitochondrial processes?

The identification of mitochondrial proteins in the ITM2B interactome suggests potential roles in mitochondrial function . Gene ontology analysis of ITM2B interactors revealed associations with oxidative phosphorylation, cellular respiration, respiratory electron transport chain, mitochondrial ATP synthesis, and NADH dehydrogenase activity . To investigate these potential mitochondrial functions, researchers can:

  • Perform subcellular fractionation to confirm ITM2B presence in mitochondrial fractions

  • Use super-resolution microscopy to visualize co-localization with mitochondrial markers

  • Measure mitochondrial function parameters (oxygen consumption, membrane potential, ATP production) in cells with modified ITM2B expression

  • Employ mitochondrial protein proximity labeling to identify the specific mitochondrial microenvironment of ITM2B

  • Create domain deletion mutants to identify regions responsible for mitochondrial association

  • Compare mitochondrial function in human versus chimpanzee cells with equivalent ITM2B modifications

These approaches would help elucidate whether ITM2B directly participates in mitochondrial processes or influences them indirectly through its interacting partners.

What are the key differences between human and chimpanzee ITM2B?

While specific comparative data on ITM2B between humans and chimpanzees is limited in the available literature, several potential areas of difference may exist:

FeaturePotential DifferencesFunctional Implications
Sequence variationsMinor amino acid differences in functional domainsAltered interaction affinities, processing efficiency
Post-translational modification sitesDifferent patterns of phosphorylation/glycosylationModified regulation of processing and activity
Promoter regionsVariations affecting expression levelsDifferent tissue distribution or stress responses
Proteolytic processingEfficiency of cleavage by proteasesAltered balance of protein fragments
Interactome compositionSpecies-specific binding partnersConnection to different downstream pathways

Detailed comparative studies directly examining these potential differences would provide valuable insights into the evolution of ITM2B function and potentially illuminate species-specific aspects of neurodegeneration susceptibility .

How can understanding Pan troglodytes ITM2B inform human disease research?

Comparative studies between human and chimpanzee ITM2B can provide unique insights into neurodegenerative disease mechanisms. Despite their genetic similarity, chimpanzees appear less susceptible to certain neurodegenerative conditions that affect humans, including Alzheimer's disease . Investigating whether differences in ITM2B structure, processing, or regulation contribute to this differential susceptibility could reveal protective mechanisms with therapeutic potential.

Key research directions include:

  • Comparing APP processing modulation by human versus chimpanzee ITM2B

  • Examining species-specific differences in ITM2B's interaction with the proteolytic machinery

  • Analyzing differential susceptibility of ITM2B-derived peptides to form amyloid aggregates

  • Investigating species-specific interactomes that might confer protection against neurodegeneration

  • Examining ITM2B expression patterns across brain regions in both species

These comparative approaches could identify naturally evolved protective mechanisms in chimpanzees that might be therapeutically mimicked in humans for treating ITM2B-related pathologies .

What are common challenges when working with recombinant ITM2B?

Researchers working with recombinant Pan troglodytes ITM2B face several technical challenges inherent to membrane protein studies:

  • Low expression yields: Transmembrane proteins often express poorly in heterologous systems. Optimization of codon usage, consideration of fusion partners (SUMO, MBP), adjustment of induction conditions, or use of specialized expression strains may improve yields.

  • Protein aggregation: ITM2B may aggregate during expression or purification. Screening multiple detergents, including stabilizing agents (glycerol, specific lipids), optimizing buffer conditions, or expressing only soluble domains can mitigate this issue.

  • Improper proteolytic processing: Recombinant systems may not faithfully reproduce the native regulated intramembrane proteolysis observed with ITM2B . Co-expression of relevant proteases (such as ADAM10 and SPPL2a/b), verification of processing by mass spectrometry, or use of cell lines with appropriate processing machinery may be necessary.

  • Post-translational modification heterogeneity: Variable glycosylation or phosphorylation can complicate analysis, particularly given the importance of phosphorylation in regulating ITM2B processing . Using homogeneous expression systems, enzymatic treatments to remove modifications when necessary, or site-directed mutagenesis to eliminate modification sites may provide more consistent preparations.

  • Functional assay limitations: Determining if recombinant ITM2B retains native functionality requires robust assays. Developing activity measures (e.g., APP processing inhibition), assessing binding to known partners, or comparing biophysical properties to native protein are essential validation steps.

How can researchers address issues with ITM2B solubility and stability?

Membrane proteins like ITM2B present significant challenges for maintaining solubility and stability during expression and purification. Several strategies can be employed:

ChallengeSolution StrategyImplementation Approach
Detergent selectionSystematic screeningTest panel of 8-12 detergents from different classes
Detergent concentrationOptimizationDetermine minimum concentration for solubilization
Lipid supplementationNative-like environmentAdd specific phospholipids during purification
Buffer optimizationStability screeningTest pH range, salt concentrations, additives
Temperature sensitivityStorage conditionsDetermine optimal temperature for short/long-term storage
Stabilizing mutationsProtein engineeringIntroduce disulfide bonds or remove aggregation-prone regions
Alternative solubilizationNanodiscs/AmphipolsReconstitute into membrane-mimetic environments

Each of these approaches addresses a specific aspect of the solubility/stability challenge. Often, a combination of strategies is required for optimal results. Biophysical characterization techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) can verify monodispersity and proper oligomeric state throughout the optimization process .

What emerging approaches might advance Pan troglodytes ITM2B research?

Several promising research directions and emerging technologies could significantly advance our understanding of Pan troglodytes ITM2B:

  • Cryo-electron microscopy for membrane protein structural determination, potentially revealing the three-dimensional structure of ITM2B in different processing states

  • Single-cell proteomics to examine cell-type-specific expression and processing of ITM2B in chimpanzee brain tissues

  • Organoid models derived from chimpanzee induced pluripotent stem cells to study ITM2B function in a developmentally relevant context

  • CRISPR-engineered models with tagged endogenous ITM2B or specific mutations to study protein dynamics and function in chimpanzee cell lines

  • Comparative interactomics across primate species to identify conserved and divergent interaction networks

  • Advanced imaging techniques such as lattice light-sheet microscopy combined with specific labeling to visualize ITM2B trafficking and processing in living cells

  • Machine learning approaches to predict species-specific functional differences based on sequence variations

These approaches leverage cutting-edge technologies to address fundamental questions about ITM2B biology and its relevance to primate evolution and human disease .

How might understanding ITM2B in chimpanzees inform evolutionary neuroscience?

Comparative studies of ITM2B between humans and chimpanzees could provide unique insights into brain evolution:

  • The divergence in neurological development and disease susceptibility between humans and chimpanzees may partially relate to ITM2B function through several mechanisms

  • Given ITM2B's role in amyloid precursor protein processing, species-specific differences might influence neuronal development, plasticity, and susceptibility to amyloid-related pathologies

  • The apparent association of ITM2B with mitochondrial proteins could affect neuronal energy metabolism, which is critically important for the energy-demanding human brain

  • Differences in ITM2B's interaction with cytoskeletal components could influence neuronal migration, axon guidance, or synapse formation during development

  • The bioactive peptides generated from ITM2B processing might have species-specific activities in signaling pathways relevant to neuronal development or survival

Comparative studies examining these aspects could provide unique insights into how subtle molecular differences contribute to the dramatic cognitive differences between humans and our closest evolutionary relatives .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.