Recombinant Pan troglodytes Interferon alpha-inducible protein 6 (IFI6)

Shipped with Ice Packs
In Stock

Description

Definition and General Overview of IFI6

IFI6 (also known as G1P3, ISG16, or IFI6-16) is a 13–16 kDa protein induced by type I interferons (IFN-α/β) and other innate immune stimuli . It is evolutionarily conserved across mammals, with orthologs identified in primates, rodents, and other species . IFI6 plays dual roles in immunomodulation and antiviral defense, though its precise molecular mechanisms remain under investigation .

Key Functions of IFI6:

RoleMechanismExamplesReferences
Negative RegulationSuppresses RIG-I activation by RNA-binding, reducing IFN/ISG responsesInhibits IAV, SARS-CoV-2, and Sendai virus replication via antiviral feedback
Antiviral ActivityDirectly inhibits viral promoters (e.g., HBV EnhII/Cp) or disrupts entryReduces HBV DNA replication and HCV entry by targeting EGFR signaling
Apoptosis ModulationBlocks intrinsic apoptosis pathways (e.g., TNFSF10) or promotes senescenceContext-dependent pro-apoptotic/pro-survival roles in melanoma models

Molecular and Functional Characteristics

Human IFI6 is localized to the endoplasmic reticulum and nucleus , where it interacts with viral RNA or DNA to modulate replication. For example:

  • HBV Suppression: Binds EnhII/Cp promoter (1715–1770 nt) to inhibit transcription .

  • Flavivirus Inhibition: Prevents ER membrane invaginations critical for replication .

Experimental Models and Techniques

Recombinant human IFI6 has been engineered using plasmid systems (e.g., pCAGGS-IFI6-HA) for in vitro and in vivo studies . Key approaches include:

  • Knockout/Knockdown: CRISPR-Cas9 or siRNA to study loss-of-function effects .

  • Hydrodynamic Injection: Delivering IFI6 plasmids into mice to assess in vivo antiviral efficacy .

Potential Applications for Recombinant Pan troglodytes IFI6

While no data exist for Pan troglodytes IFI6, extrapolation from human studies suggests potential uses:

ApplicationRationaleHuman Precedent
Antiviral TherapiesTargeting viral promoters (e.g., HBV, SARS-CoV-2) or replication machineryIFI6 inhibits HBV replication via promoter binding ; suppresses IAV/SARS-CoV-2 via RIG-I modulation
Cancer TreatmentDisrupting DNA replication stress in NRAS-mutant melanomaIFI6 knockdown sensitizes melanoma to replication stress-inducing drugs
Immune ModulationDampening excessive IFN responses in autoimmune diseasesIFI6 KO cells show hyperinflammatory profiles, suggesting therapeutic targeting

Lack of Pan troglodytes-Specific Data

No studies have characterized:

  • Sequence Conservation: Alignment of Pan troglodytes IFI6 with human/primate orthologs.

  • Functional Redundancy: Whether chimpanzee IFI6 retains antiviral or apoptotic roles observed in humans.

  • Recombinant Engineering: Expression systems (e.g., bacterial, mammalian) for producing Pan troglodytes IFI6.

Technical Challenges

  • RNA-Binding Specificity: Does Pan troglodytes IFI6 target viral RNA/DNA with the same affinity as human IFI6?

  • Cross-Species Activity: Efficacy of Pan troglodytes IFI6 in human or non-primate models.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
IFI6; Interferon alpha-inducible protein 6; Interferon-induced protein 6-16; Ifi-6-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-130
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
IFI6
Target Protein Sequence
GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILN GGGVPAGGLVATLQSLGAGGSSVITGNIGALMGYATHKYLDSEEDEE
Uniprot No.

Target Background

Function
Plays a role in apoptosis, negatively regulating the intrinsic apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been demonstrated to possess pro-apoptotic activity. May exhibit antiviral properties.
Database Links
Protein Families
IFI6/IFI27 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What experimental models are most effective for studying IFI6's dual role in antiviral defense and immune regulation?

Recombinant IFI6 studies typically employ cellular models (e.g., A549, BEAS-2B, 293T, HAP-1) for in vitro assays to evaluate its interaction with viral components or host proteins like RIG-I . For in vivo validation, murine models or humanized systems (e.g., liver chimeric mice) are critical to assess antiviral efficacy and immune modulation .

Key methodologies:

ModelApplicationAdvantagesLimitations
Cell lines (A549)RT-qPCR, viral replication assaysHigh throughput, reproducibilityLimited to acute infection dynamics
Murine modelsIn vivo IFI6 knockout studiesMimics systemic immune responseSpecies-specific IFI6 expression may vary
Viral entry assaysPoly(I:C) transfection, rVSV-GFP infectionMeasures innate immune activationOverexpression artifacts may skew results

How can researchers validate IFI6's RNA-binding ability in viral replication contexts?

IFI6’s RNA-binding capacity is hypothesized to modulate RIG-I activation . Validation requires:

  • Co-immunoprecipitation (Co-IP): Identify IFI6-RNA complexes using tagged IFI6 constructs.

  • Fluorescence microscopy: Track colocalization of IFI6 with viral RNA or ER-associated structures (e.g., double-membrane vesicles in flavivirus-infected cells) .

  • RNA interference (RNAi): Knockdown IFI6 and assess RIG-I activation via phospho-IRF3 assays .

What challenges arise when analyzing IFI6's conflicting roles in apoptosis and immune regulation?

IFI6 exhibits context-dependent functions:

  • Anti-apoptotic: Blocks cytochrome c release and stabilizes mitochondrial membranes .

  • Pro-apoptotic: Induces TNFSF10-mediated apoptosis in certain contexts .

Data reconciliation strategies:

  • Cell-type specificity analysis: Compare IFI6 effects in immune cells (e.g., macrophages) vs. epithelial cells (e.g., A549).

  • Kinetic studies: Time-course experiments to distinguish early antiviral vs. late apoptotic phases .

  • Signaling pathway inhibitors: Use EGFR kinase inhibitors to dissect IFI6’s role in HCV entry vs. apoptosis .

How does IFI6's interaction with RIG-I influence innate immune responses during viral infections?

IFI6 binds RIG-I via RNA intermediates, preventing its activation and downstream IFN/ISG production . This mechanism is critical in:

  • Reducing cytokine storms: IFI6 knockdown exacerbates IFN-λ1 and pro-inflammatory cytokine expression in IAV/SARS-CoV-2 infections .

  • Viral replication control: IFI6 overexpression suppresses IAV and SARS-CoV-2 titers by limiting antiviral gene activation .

What bioinformatics tools are essential for predicting IFI6's structural interactions with viral components?

Key tools:

  • Homology modeling: Predict IFI6’s 3D structure using templates like FAM14 family proteins.

  • Protein-RNA docking: Tools like HDOCK or Rosetta to simulate IFI6-RNA binding .

  • Phylogenetic analysis: Compare IFI6 orthologs (e.g., chicken IFI6 ) to identify conserved RNA-binding motifs.

How to design experiments to study IFI6's species-specific effects on avian reovirus (ARV)?

Avian IFI6’s role in ARV replication requires:

  • Cloning and overexpression: Use avian cell lines (e.g., ESCC) to express recombinant IFI6 .

  • Subcellular localization: Fluorescent tagging to confirm ER localization and interaction with viral replication compartments .

  • Viral titration: Quantify ARV replication in IFI6 knockdown vs. control cells .

What methodological limitations exist when using recombinant IFI6 in in vitro vs. in vivo systems?

SystemStrengthsWeaknesses
In vitroControlled environment, high reproducibilityLack of physiological complexity
In vivoMimics systemic immune responsesSpecies-specific IFI6 expression challenges

How to analyze data contradictions between IFI6's antiviral and immune-regulatory functions?

Approach:

  • Contextual analysis: Compare IFI6 effects in early (antiviral) vs. late (immune regulation) infection stages .

  • Multi-omics integration: Combine transcriptomics (IFN/ISG expression) and metabolomics (reactive oxygen species) .

  • Dose-response studies: Assess IFI6 concentration thresholds for antiviral vs. immunosuppressive effects .

What are the key considerations for studying IFI6 in non-human primates (e.g., Pan troglodytes)?

Critical factors:

  • Ortholog identification: Confirm IFI6 sequence conservation between Pan troglodytes and model organisms .

  • Tissue-specific expression: Profile IFI6 in respiratory vs. hepatic tissues during viral infections .

  • Ethical constraints: Prioritize in vitro models (e.g., primary primate cells) over in vivo testing.

How to optimize recombinant IFI6 production for structural studies?

Protein purification workflow:

  • Expression system: Wheat germ-based systems for full-length IFI6 (1–130 aa) .

  • Affinity tags: HA or FLAG tags for immunoprecipitation .

  • Post-translational modifications: Assess disulfide bonds via reducing/non-reducing SDS-PAGE .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.