Recombinant Pan troglodytes Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pan troglodytes Melanocyte-Stimulating Hormone Receptor (MC1R)

The melanocortin 1 receptor (MC1R) is a G-protein coupled receptor (GPCR) critical for regulating pigmentation, ultraviolet (UV) response, and melanoma risk. While specific recombinant MC1R proteins from Pan troglodytes (chimpanzee) are not explicitly detailed in available literature, studies on MC1R structure, function, and recombinant production in related primate species provide a framework for understanding its potential applications. This article synthesizes data on MC1R biology, structural features, and recombinant production methodologies, extrapolating insights relevant to Pan troglodytes MC1R.

Recombinant MC1R Production and Applications

Recombinant MC1R proteins are engineered for structural and functional studies. While Pan troglodytes MC1R is not directly reported, analogous protocols from other primates (e.g., Leontopithecus chrysomelas, Erythrocebus patas) illustrate standard methods:

ParameterDetailsExample Source
Expression SystemBacterial (E. coli) or mammalian (HEK293) systems
TaggingN-terminal His-tag for purification via Ni-NTA affinity chromatography
Purity>90% via SDS-PAGE; lyophilized for long-term storage (-20°C/-80°C)
ApplicationsLigand binding assays, trafficking studies, and mutation analysis

Key Challenges:

  • Trafficking Defects: Mutants like R151C and R160W show ER retention or altered surface expression .

  • Species-Specific Variations: MC1R diversity differs across populations (e.g., higher in Eurasians vs. Africans) .

MC1R Polymorphisms and Disease Risk

Loss-of-function MC1R variants (e.g., R151C, R160W, D294H) are linked to:

  • Red Hair/Fair Skin Phenotype (RHC): Increased pheomelanin, UV sensitivity, and melanoma risk .

  • DNA Repair Deficits: Reduced NER efficiency, contributing to UV-induced mutagenesis .

Population Genetics Insights

  • Melanesian MC1R Diversity: Lower diversity in high-UV populations (e.g., Northern Island Melanesians) suggests purifying selection .

  • Admixed Populations: High MC1R polymorphism in admixed groups (e.g., Rio de Janeiro, Brazil) highlights complex pigmentation genetics .

Recombinant MC1R in Functional Studies

Recombinant proteins enable:

  • Ligand Binding Assays: Testing α-MSH, agouti, and β-defensin 3 interactions .

  • Trafficking Analysis: Tracking ER-to-plasma membrane transport defects in mutant MC1R .

  • Structural Modeling: Mapping dimerization interfaces and disulfide bonds .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENMLVV ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQVDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLFSTLFI AYCDHTAVLLCLVVFFLAVLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF HSQELRRTLKEVLTCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) is a receptor for α, β, and γ MSH and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of MC1R in Pan troglodytes compared to human MC1R?

MC1R (Melanocortin 1 Receptor) functions as a G-protein-coupled receptor in both humans and chimpanzees, primarily expressed on the surface of melanocytes. In both species, MC1R activation by α-MSH (alpha-melanocyte stimulating hormone) stimulates the adenylyl cyclase pathway, leading to increased cAMP production and subsequent melanogenesis .

How does recombinant Pan troglodytes MC1R differ from human recombinant MC1R in experimental systems?

Recombinant Pan troglodytes MC1R maintains the fundamental structure and signaling properties of human MC1R but differs in several experimental aspects:

  • Conservation of functional domains: While both receptors share key functional domains required for α-MSH binding and G-protein coupling, sequence variations may affect ligand binding affinities and downstream signaling efficiency .

  • Expression system compatibility: Both recombinant proteins can be expressed in various systems including E. coli, yeast, baculovirus, and mammalian cells with comparable efficiency, but may require species-specific optimization for maximum yield .

  • Post-translational modifications: Glycosylation patterns and palmitoylation sites may differ slightly between human and chimpanzee MC1R, potentially affecting trafficking and cell-surface expression .

  • Antibody cross-reactivity: Many antibodies developed against human MC1R cross-react with Pan troglodytes MC1R due to high sequence homology, though epitope-specific antibodies may show differential binding .

What are the recommended expression systems for producing functional recombinant Pan troglodytes MC1R?

Several expression systems have been validated for producing functional recombinant Pan troglodytes MC1R, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical YieldRecommended for
E. coliCost-effective, rapid expression, suitable for structure studiesLimited post-translational modifications, potential for inclusion bodies3-5 mg/LStructural studies, antibody production
Yeast (P. pastoris)Proper protein folding, some post-translational modificationsLonger production time, different glycosylation pattern1-3 mg/LFunctional studies requiring partial modifications
Baculovirus/Insect cellsHigher-order eukaryotic modifications, proper membrane insertionMore complex protocols, higher cost1-2 mg/LSignaling studies, ligand binding assays
Mammalian cellsNative-like post-translational modifications, proper foldingHighest cost, complex protocols, lower yield0.5-1 mg/LTrafficking studies, complex functional assays
Cell-free expressionRapid production, avoids cellular toxicityLimited yield, higher cost0.1-0.3 mg/LRapid screening, producing toxic variants

Current research suggests that mammalian expression systems (particularly HEK293 or CHO cells) provide the most physiologically relevant recombinant Pan troglodytes MC1R for functional studies, while E. coli-derived protein is suitable for structural and immunological applications .

How should researchers design experiments to study MC1R trafficking differences between human variants and Pan troglodytes MC1R?

To effectively study MC1R trafficking differences between human variants and Pan troglodytes MC1R, researchers should implement a multi-stage experimental design:

  • Construct preparation: Generate expression vectors containing Flag-epitope labeled wild-type human MC1R, selected human MC1R variants (R151C, R160W, D294H), and Pan troglodytes MC1R .

  • Cellular localization studies: Transfect constructs into appropriate cell lines (melanoma cells like HBL or HEK293 cells) and co-transfect with organelle markers:

    • EGFP-Rab1 for ER-to-Golgi trafficking

    • CFP-GalTr for trans-Golgi network

    • Use antibodies against calnexin (ER), GM130 (cis-Golgi), and COPI (transport vesicles) .

  • Quantitative trafficking assessment: Perform metabolic labeling with 35S followed by immunoprecipitation and EndoH treatment to assess glycosylation status, which indicates progression through the secretory pathway .

  • Surface expression analysis: Implement cell surface biotinylation assays or flow cytometry with anti-Flag antibodies (non-permeabilized conditions) to quantify receptor density at the plasma membrane .

  • Palmitoylation assays: Assess the role of palmitoylation in MC1R trafficking using metabolic labeling with [3H]palmitate, palmitoylation inhibitors, and site-directed mutagenesis of potential palmitoylation sites .

This multifaceted approach will reveal whether Pan troglodytes MC1R exhibits trafficking patterns similar to human wild-type MC1R or more closely resembles certain human variants, providing insights into evolutionary adaptations of receptor regulation .

What are the critical controls and validation steps when studying α-MSH binding to recombinant Pan troglodytes MC1R compared to human variants?

To ensure rigorous assessment of α-MSH binding characteristics between recombinant Pan troglodytes MC1R and human variants, researchers should implement the following controls and validation steps:

  • Receptor expression normalization:

    • Quantify receptor expression levels using Western blot and ELISA

    • Ensure comparable cell surface expression using flow cytometry or cell-surface biotinylation

    • Generate stable cell lines with defined receptor densities (aim for 0.3-1.0 fmol/μg protein)

  • Binding assay controls:

    • Use both labeled synthetic α-MSH and natural α-MSH preparations

    • Include positive controls (wild-type human MC1R)

    • Include negative controls (non-transfected cells and cells expressing unrelated GPCRs)

    • Always run competitive binding assays with unlabeled ligand

  • Functional validation:

    • Measure cAMP accumulation using sensitive reporter systems

    • Assess ERK1/2 phosphorylation as a secondary pathway

    • Quantify calcium mobilization where appropriate

    • Compare EC50 and Emax values between species variants

  • Confirmation of protein integrity:

    • Circular dichroism to verify secondary structure

    • Limited proteolysis to assess protein folding

    • Thermal stability assays to determine protein robustness

  • Cross-species comparisons:

    • Include gorilla and orangutan MC1R variants when possible

    • Determine if observed differences align with known evolutionary divergence patterns

These controls will distinguish genuine species differences from artifacts related to experimental conditions or protein preparation methods.

How can researchers effectively use Pan troglodytes MC1R to investigate evolutionary adaptations in MC1R function across primate lineages?

To effectively investigate evolutionary adaptations in MC1R function across primate lineages using Pan troglodytes MC1R as a comparative model, researchers should follow this methodological framework:

  • Comprehensive sequence analysis:

    • Perform phylogenetic analysis of MC1R sequences from diverse primate species

    • Calculate KA/KS ratios (nonsynonymous to synonymous substitution rates) to identify sites under selection

    • Implement Bayesian methods to detect lineage-specific selection patterns

  • Functional comparative assays:

    • Express recombinant MC1R from humans, chimpanzees, and other primates in identical cellular contexts

    • Conduct dose-response studies with α-MSH to determine comparative signaling efficiency

    • Measure eumelanin/pheomelanin production ratios in transfected melanocytes

  • Structural biology approaches:

    • Generate homology models based on crystal structures of related GPCRs

    • Identify species-specific differences in ligand binding pockets and G-protein interaction domains

    • Validate models through site-directed mutagenesis and functional rescue experiments

  • Promoter and regulatory region analysis:

    • Sequence and compare the 5' upstream regions (~6.6 kb) of MC1R genes from various primates

    • Identify potential transcription factor binding sites through phylogenetic footprinting

    • Perform reporter assays to quantify differential promoter activity

  • Analysis of selective pressures:

    • Compare MC1R variation patterns between human populations and non-human primate species

    • Test for signals of relaxed functional constraints versus diversifying selection

    • Correlate genetic findings with phenotypic differences in pigmentation across species

This comprehensive approach will provide insights into how MC1R function has evolved across primate lineages and identify the molecular basis for species-specific adaptations in pigmentation.

What methods are recommended for assessing cAMP production following α-MSH stimulation of recombinant Pan troglodytes MC1R?

For robust assessment of cAMP production following α-MSH stimulation of recombinant Pan troglodytes MC1R, researchers should consider these methodological approaches:

  • Real-time cAMP measurement:

    • Implement FRET-based biosensors (like EPAC-camps) in living cells expressing recombinant MC1R

    • This allows temporal resolution of cAMP dynamics and detection of subtle differences in activation kinetics

    • Can be combined with fluorescently-tagged receptors to correlate receptor localization with function

  • Enzyme immunoassay (EIA) approaches:

    • Use competitive EIA kits designed for cAMP quantification

    • Include phosphodiesterase inhibitors (IBMX) to prevent cAMP degradation

    • Perform time-course studies (5-60 minutes) and concentration-response curves (10^-12 to 10^-6 M α-MSH)

    • Always normalize results to total protein or cell number

  • Reporter gene assays:

    • Employ CRE-luciferase reporter constructs that respond to cAMP-dependent PKA activation

    • Co-transfect with MC1R expression vectors in appropriate cell lines

    • Include positive controls (forskolin) and negative controls (vehicle-only)

    • Allows high-throughput screening of multiple conditions simultaneously

  • Radioisotope-based methods:

    • Label cells with [3H]adenine to generate [3H]ATP pool

    • Measure conversion to [3H]cAMP after receptor stimulation

    • Provides high sensitivity but requires appropriate radioisotope handling facilities

When comparing human and chimpanzee MC1R, researchers should design experiments that can detect potential differences in:

  • Basal activity (constitutive signaling)

  • Potency (EC50) and efficacy (maximum response)

  • Signal duration and desensitization kinetics

  • Responses to partial agonists

This battery of approaches will provide comprehensive insights into potential functional differences between human and Pan troglodytes MC1R signaling capabilities .

How should researchers investigate the role of Pan troglodytes MC1R in DNA repair mechanisms compared to human MC1R variants?

To systematically investigate differences in DNA repair functions between Pan troglodytes MC1R and human MC1R variants, researchers should implement this methodological framework:

  • Cell model establishment:

    • Generate isogenic melanocyte lines expressing equivalent levels of either:

      • Wild-type human MC1R

      • Human MC1R variants (particularly R151C, R160W, D294H)

      • Pan troglodytes MC1R

    • Use CRISPR/Cas9 to knockout endogenous MC1R in human melanocytes before introducing recombinant constructs

  • DNA damage induction:

    • Expose cells to controlled UV radiation doses (50-100 J/m²)

    • Alternatively, use chemical agents that induce specific DNA lesions (H₂O₂, 4-NQO, etc.)

    • Implement micro-irradiation techniques for spatiotemporal analysis of repair protein recruitment

  • Quantification of DNA damage and repair:

    • Measure cyclobutane pyrimidine dimers (CPDs) and 6-4 photoproducts using specific antibodies

    • Perform comet assays to quantify DNA strand breaks

    • Use γH2AX immunofluorescence to assess double-strand break formation and resolution

    • Implement [³H]thymidine incorporation to measure unscheduled DNA synthesis

  • Signaling pathway analysis:

    • Assess ATR phosphorylation at S435 via immunoblotting and immunofluorescence

    • Monitor XPA recruitment to DNA damage sites using chromatin immunoprecipitation

    • Measure nucleotide excision repair capacity through host-cell reactivation assays

    • Quantify p53 activation and downstream target gene expression

  • Chromosome stability assessment:

    • Perform metaphase spread analysis to quantify chromosomal aberrations

    • Specifically examine centromeric fragmentation frequency

    • Use fluorescence in situ hybridization to detect specific chromosomal abnormalities

    • Implement live-cell imaging to track chromosomal dynamics during mitosis

This comprehensive approach will reveal whether Pan troglodytes MC1R exhibits similar, enhanced, or reduced DNA repair capabilities compared to human MC1R variants, providing insights into evolutionary adaptations in this critical protective function .

What experimental approaches can distinguish between the effects of MC1R variants on trafficking versus signaling defects?

To effectively distinguish between trafficking and signaling defects in MC1R variants (comparing human variants to Pan troglodytes MC1R), researchers should employ the following experimental strategy:

  • Two-step trafficking assessment:

    • Subcellular fractionation and Western blotting: Separate plasma membrane, ER, Golgi, and endosomal fractions to quantitatively determine receptor localization

    • Confocal microscopy with organelle co-localization: Use fluorescently-tagged organelle markers (calnexin for ER, GM130 for Golgi) alongside MC1R staining to determine where variants accumulate

    • Quantitative surface biotinylation: Measure the percentage of total receptor reaching the cell surface using membrane-impermeable biotinylation reagents

    • Glycosylation status analysis: Use EndoH and PNGase F treatments to distinguish between immature (ER-retained) and mature (post-Golgi) receptor populations

  • Direct signaling capacity assessment:

    • Cell-free reconstitution: Purify receptors and reconstitute with G proteins in lipid nanodiscs to measure intrinsic signaling capacity independent of trafficking

    • Forced surface expression: Use addition of cell-surface targeting motifs or pharmacological chaperones to normalize surface expression before measuring signaling

    • Adenylyl cyclase activation assay: Prepare membrane fractions with normalized receptor content and measure α-MSH-stimulated cyclase activity in vitro

    • G-protein coupling efficiency: Measure GTPγS binding to determine if variants affect the receptor's ability to activate G proteins

  • Comprehensive comparative table:

Receptor VariantSurface Expression (% of WT)Normalized cAMP Response*Intracellular LocationPalmitoylation StatusPrimary Defect
Human WT100%100%Plasma membraneNormalNone
Human R151C20-40%70-90%ERReducedTrafficking
Human R160W30-50%60-80%cis-GolgiReducedTrafficking
Human D294H70-90%40-60%Plasma membraneNormalSignaling
Pan troglodytes MC1R80-100%90-100%Plasma membraneNormalNone
Other variants..................

*Normalized cAMP response: Signaling capacity when surface expression is normalized through various methods

This systematic approach will definitively distinguish between variants that primarily affect trafficking (but retain signaling capacity) versus those that reach the cell surface but are intrinsically defective in signaling .

How can researchers design experiments to investigate the differential selective pressures on MC1R between humans and Pan troglodytes?

To robustly investigate differential selective pressures on MC1R between humans and Pan troglodytes, researchers should implement a multi-layered experimental design:

  • Population genetics analysis:

    • Sequence the MC1R coding region and regulatory elements (6.6kb upstream) in:

      • Large sample (n>100) of diverse human populations

      • Similar sample size of Pan troglodytes from different subspecies and geographical regions

    • Calculate population genetics parameters:

      • Nucleotide diversity (π)

      • Tajima's D

      • Fay and Wu's H

      • HKA test

      • McDonald-Kreitman test

    • Compare these values between species to identify differences in selection patterns

  • Functional comparative genomics:

    • Create a panel of chimeric MC1R constructs swapping domains between human and chimpanzee receptors

    • Identify functionally important changes through complementation assays in MC1R-null melanocytes

    • Measure differences in:

      • Basal activity

      • Ligand responsiveness

      • Resistance to UV-induced damage

      • Interaction with melanocortin receptor accessory proteins (MRAPs)

  • Evolutionary reconstruction experiments:

    • Generate ancestral sequence reconstructions of MC1R at key evolutionary nodes

    • Express these reconstructed receptors in appropriate cell systems

    • Measure functional changes that occurred along each lineage

    • Correlate with known environmental transitions in primate evolution

  • Pigmentation phenotype correlation:

    • Collect matched MC1R genotype and pigmentation phenotype data from human and chimpanzee populations

    • Develop quantitative measures of skin/hair pigmentation applicable across species

    • Test for genotype-phenotype associations in both species

    • Investigate whether the same variants have consistent effects across species

This comprehensive approach will allow researchers to determine how selection has shaped MC1R function differently in humans versus chimpanzees, potentially revealing evolutionary adaptations related to habitat, UV exposure, and other environmental factors .

What protocols are most effective for analyzing MC1R promoter activity differences between human and Pan troglodytes?

To effectively analyze MC1R promoter activity differences between human and Pan troglodytes, researchers should implement the following comprehensive protocol:

  • Promoter region identification and cloning:

    • Isolate and sequence the 6.6 kb region upstream of MC1R coding sequence from both species

    • Focus particularly on the minimal promoter and potential enhancer regions

    • Generate a series of 5' deletion constructs (full length, 3kb, 1kb, 500bp, 250bp) to identify key regulatory regions

    • Clone these fragments into luciferase reporter vectors with minimal promoter elements

  • Transcription factor binding site analysis:

    • Perform in silico comparative analysis to identify conserved and divergent TFBS between species

    • Use tools like JASPAR, TRANSFAC, and phylogenetic footprinting

    • Prioritize investigation of:

      • MITF binding sites (E-box elements)

      • USF-1 binding sites

      • CREB/ATF sites

      • SOX10 binding regions

  • Cell-specific reporter assays:

    • Transfect reporter constructs into:

      • Human and chimpanzee melanocyte lines

      • Human and chimpanzee keratinocytes (for paracrine effects)

      • Cell lines derived from different human populations

    • Measure basal promoter activity

    • Assess responsiveness to stimuli:

      • UV radiation

      • α-MSH

      • Inflammatory cytokines

      • Growth factors

  • Chromatin structure analysis:

    • Perform comparative ChIP-seq for histone modifications in the MC1R locus

    • Analyze DNase I hypersensitivity patterns

    • Conduct ATAC-seq to assess chromatin accessibility

    • Implement chromosome conformation capture (3C, 4C, Hi-C) to identify long-range interactions

  • Functional validation of key differences:

    • Introduce specific mutations to convert human sequences to chimpanzee sequences and vice versa

    • Create chimeric promoters with elements from both species

    • Validate the functional importance of identified variations using CRISPR-mediated genome editing

    • Correlate promoter variants with expression levels in primary tissue samples

This comprehensive approach will reveal the molecular basis for any species-specific differences in MC1R expression regulation and provide insights into the evolutionary divergence of this critical pigmentation gene between humans and chimpanzees .

How should researchers approach the analysis of MC1R length variation in primates compared to the conserved 317 amino acid structure in humans and Pan troglodytes?

To systematically analyze MC1R length variation across primates in comparison to the conserved 317 amino acid structure in humans and Pan troglodytes, researchers should implement this comprehensive methodology:

  • Comprehensive sequence collection and alignment:

    • Gather complete MC1R coding sequences from:

      • All great ape species (Pan troglodytes, Pan paniscus, Gorilla gorilla, Pongo)

      • Old World monkeys (multiple species from Cercopithecidae)

      • New World monkeys (focusing on Platyrrhini with variable coat colors)

      • Prosimians (particularly lemur species with diverse coloration)

    • Create codon-aligned sequences using MUSCLE or MAFFT algorithms

    • Visualize alignments with conservation scoring using tools like Jalview

  • Structural domain analysis of length variants:

    • Map variations to known functional domains:

      • N-terminal extracellular domain

      • Seven transmembrane domains

      • Intracellular loops (particularly il2 containing critical R151/R160 residues)

      • C-terminal tail (containing palmitoylation sites)

    • Analyze whether length variations affect key functional motifs:

      • DRY motif in TM3

      • NPXXY motif in TM7

      • 160RARR163 arginine-based motif in il2

  • Experimental functional characterization:

    • Clone and express representative length variants in appropriate cell systems

    • Compare:

      • Cell surface trafficking efficiency

      • Ligand binding properties

      • G-protein coupling efficacy

      • Desensitization and internalization kinetics

      • Signaling pathway activation

    • Conduct molecular dynamics simulations to predict structural impacts

  • Correlation with phenotypic data:

    • Document coat/skin color patterns in species with MC1R length variations

    • Analyze whether length variations correlate with:

      • Habitat type (arboreal vs. terrestrial)

      • Geographical distribution (UV exposure)

      • Social/sexual signaling functions of coloration

      • Taxonomic relationships

  • Evolutionary rate analysis:

    • Calculate substitution rates within constant-length regions versus variable regions

    • Apply branch-site models to detect episodic selection

    • Reconstruct ancestral sequences at key nodes in primate phylogeny

    • Estimate the timing of indel events in MC1R evolution

This multi-faceted approach will provide insights into the functional significance of MC1R length variations across primate evolution, potentially revealing why the 317 amino acid structure is conserved in humans and chimpanzees despite variations in other primate lineages .

How can researchers effectively utilize Pan troglodytes MC1R as a comparative control in studies of human MC1R variants associated with melanoma risk?

To effectively utilize Pan troglodytes MC1R as a comparative control in studies of human MC1R variants associated with melanoma risk, researchers should implement the following methodological framework:

  • Comparative functional profiling:

    • Express Pan troglodytes MC1R alongside wild-type human MC1R and human RHC variants (R151C, R160W, D294H) in melanocyte and melanoma cell lines

    • Compare:

      • UV-induced DNA damage response

      • DNA repair efficiency (particularly nucleotide excision repair)

      • Cell survival following UV exposure

      • Chromosomal stability maintenance

      • Centromere integrity

  • Genomic damage assessment protocol:

    • Expose cells to clinically relevant UV doses

    • Quantify:

      • Cyclobutane pyrimidine dimer (CPD) formation

      • 6-4 photoproduct generation

      • Oxidative DNA damage (8-oxo-dG)

      • Persistence of DNA lesions over time

    • Compare DNA repair kinetics between Pan troglodytes MC1R and human variants

  • Oncogenic pathway analysis:

    • Assess how Pan troglodytes MC1R versus human variants differentially regulate:

      • PI3K/AKT signaling

      • MAPK pathway activation

      • p53-dependent responses

      • Cell cycle checkpoint functions

    • Determine whether chimpanzee MC1R provides enhanced protection against oncogenic transformation

  • Melanoma cell behavior modulation:

    • Introduce Pan troglodytes MC1R into human melanoma cell lines with defective MC1R

    • Compare effects on:

      • Proliferation rates

      • Invasive capacity

      • Apoptotic resistance

      • Treatment response

    • Determine if chimpanzee MC1R can "rescue" the malignant phenotype

  • Translation to precision medicine approaches:

    • Use insights from Pan troglodytes MC1R to identify critical domains and residues for melanoma protection

    • Design peptide mimetics or small molecules that restore protective functions to human variants

    • Develop targeted interventions for individuals with high-risk MC1R variants

This systematic approach leverages the evolutionary conservation and divergence between human and chimpanzee MC1R to gain insights into the molecular mechanisms underlying MC1R's role in melanoma susceptibility, potentially leading to novel preventive and therapeutic strategies .

What experimental design is recommended for investigating whether the Pan troglodytes MC1R can be used as a therapeutic substitute for defective human MC1R in melanoma contexts?

To systematically evaluate whether Pan troglodytes MC1R could serve as a therapeutic substitute for defective human MC1R in melanoma contexts, researchers should implement this comprehensive experimental design:

  • Comparative functional rescue assessment in cellular models:

    • Generate isogenic melanocyte and melanoma cell lines expressing:

      • Wild-type human MC1R (positive control)

      • RHC variant human MC1R (R151C, R160W, D294H)

      • Pan troglodytes MC1R

      • Empty vector (negative control)

    • Assess rescue of critical functions:

      • UV-induced cAMP signaling

      • Eumelanin/pheomelanin ratio normalization

      • DNA damage repair capacity

      • Chromosome stability

      • Cell survival following UV exposure

  • Immune interaction profiling:

    • Evaluate potential immunogenicity of Pan troglodytes MC1R:

      • Conduct in silico epitope prediction analysis

      • Perform HLA binding assays with predicted peptides

      • Test T-cell reactivity in human samples

      • Assess NK cell and innate immune recognition

  • Delivery system optimization:

    • Develop and compare delivery methods:

      • Viral vectors (lentivirus, AAV) with tissue-specific promoters

      • Non-viral approaches (lipid nanoparticles, cell-penetrating peptides)

      • Ex vivo modification of autologous melanocytes

      • Topical formulations for localized delivery

  • Preclinical animal model testing:

    • Establish xenograft models using:

      • Human melanoma cells with MC1R variants

      • Patient-derived xenografts from individuals with MC1R mutations

    • Introduce Pan troglodytes MC1R via optimized delivery system

    • Evaluate:

      • Tumor growth inhibition

      • Metastasis prevention

      • UV sensitivity normalization

      • Survival benefit

  • Safety assessment protocol:

    • Conduct comprehensive off-target analysis:

      • RNA-seq to detect altered gene expression

      • Phosphoproteomics to identify signaling changes

      • Cell behavior monitoring (proliferation, migration, differentiation)

      • Long-term stability and integration site analysis (for viral delivery)

  • Comparative advantage determination:

    • Side-by-side comparison with alternative approaches:

      • Human wild-type MC1R gene therapy

      • Pharmacological activators of downstream pathways

      • Small molecule MC1R chaperones for rescuing variant trafficking

      • Palmitoylation-enhancing strategies

This systematic approach will determine whether Pan troglodytes MC1R offers meaningful therapeutic advantages over human MC1R or other approaches, while also addressing critical safety and delivery considerations essential for clinical translation .

What methods should be used to compare binding affinities of MC1R-targeting therapeutic candidates between human and Pan troglodytes MC1R?

To rigorously compare binding affinities of MC1R-targeting therapeutic candidates between human and Pan troglodytes MC1R, researchers should implement this comprehensive methodological framework:

  • Membrane preparation optimization:

    • Generate stable cell lines expressing equivalent levels of:

      • Human wild-type MC1R

      • Human variant MC1Rs (R151C, R160W, D294H)

      • Pan troglodytes MC1R

    • Prepare membrane fractions using differential centrifugation

    • Validate receptor integrity and density using immunoblotting and radioligand binding

    • Store preparations using standardized conditions to maintain stability

  • Equilibrium binding assays:

    • Direct radioligand binding:

      • Use [125I]-labeled NDP-α-MSH or [125I]-labeled therapeutic candidates

      • Perform saturation binding to determine Bmax and Kd values

      • Conduct competition binding with unlabeled compounds to determine Ki values

      • Always include non-specific binding controls (with excess unlabeled ligand)

    • Time-resolved FRET (TR-FRET):

      • Label receptors with SNAP or CLIP tags

      • Use lanthanide-labeled antibodies or ligands as donors

      • Label therapeutic candidates with appropriate acceptor fluorophores

      • Measure binding in real-time under physiological conditions

  • Binding kinetics assessment:

    • Association kinetics: Measure the rate of ligand binding (kon)

    • Dissociation kinetics: Determine the rate of ligand unbinding (koff)

    • Calculate residence time (1/koff) as a critical parameter for therapeutic efficacy

    • Implement biolayer interferometry or surface plasmon resonance with purified receptors

  • Structural binding determinants:

    • Conduct molecular docking studies using:

      • Homology models based on related GPCR structures

      • Molecular dynamics simulations to account for receptor flexibility

      • Fragment-based approaches to identify key interaction sites

    • Validate predictions through site-directed mutagenesis of key residues that differ between species

  • Functional consequence validation:

    • Correlate binding parameters with:

      • cAMP production

      • β-arrestin recruitment

      • Receptor internalization

      • Signal duration

    • Determine if binding differences translate to functional selectivity between species

This comprehensive approach will provide detailed insights into how therapeutic candidates interact with human versus Pan troglodytes MC1R, allowing for optimization of compounds with desired species selectivity profiles and potential identification of variants with improved therapeutic properties .

What are the optimal purification strategies for obtaining high-purity recombinant Pan troglodytes MC1R for structural studies?

To obtain high-purity recombinant Pan troglodytes MC1R suitable for structural studies, researchers should implement this optimized purification strategy:

  • Expression system selection and optimization:

    • Recommended primary system: Baculovirus-infected insect cells (Sf9 or High Five)

      • Advantages: Proper folding, post-translational modifications, higher yield

      • Key optimizations: Use strong viral promoters (polh), optimize MOI (1-5), harvest at 48-72h post-infection

    • Alternative system: Mammalian cells with inducible expression

      • Advantages: Native-like processing, proper folding

      • Key optimizations: Use stable cell lines with tetracycline-inducible promoters, culture at 30°C during expression

  • Construct engineering for purification success:

    • Add N-terminal cleavable signal sequence for proper membrane insertion

    • Incorporate C-terminal affinity tags (10× His or Twin-Strep) with 3C protease cleavage site

    • Consider fusion partners that enhance expression (T4 lysozyme, rubredoxin, BRIL)

    • Optionally stabilize using thermostabilizing mutations identified through alanine scanning

  • Solubilization and extraction protocol:

    • Harvest cells and wash with PBS containing protease inhibitors

    • Disrupt cells using nitrogen cavitation or gentle sonication

    • Isolate membranes through differential centrifugation

    • Solubilize using mild detergents:

      • Primary recommendation: n-Dodecyl-β-D-maltoside (DDM) with cholesteryl hemisuccinate (CHS)

      • Alternatives: LMNG, GDN, or digitonin for specific applications

    • Maintain strict temperature control (4°C) throughout process

  • Multi-step purification strategy:

    • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography: Superdex 200 to separate monomeric receptor from aggregates

    • Optional ion exchange: For removal of remaining contaminants (MonoQ or MonoS)

    • Ligand-affinity chromatography: Using immobilized α-MSH or antagonist for final polishing

    • Quality control checkpoints: SDS-PAGE, Western blot, mass spectrometry, and N-terminal sequencing at each step

  • Stabilization for structural applications:

    • Exchange detergent for amphipols (A8-35) or nanodiscs (MSP1D1 with POPC/POPG lipids)

    • Add high-affinity ligands to stabilize specific conformations

    • Consider lipid cubic phase (LCP) reconstitution for crystallography

    • Validate final preparation using negative-stain electron microscopy and thermal stability assays

This comprehensive approach typically yields 0.5-1 mg of >95% pure, functional receptor per liter of culture, suitable for crystallography, cryo-EM, or NMR studies .

What considerations are important when developing antibodies that can distinguish between human and Pan troglodytes MC1R for comparative studies?

To develop antibodies capable of distinguishing between human and Pan troglodytes MC1R for comparative studies, researchers should consider these critical methodological factors:

  • Sequence analysis for epitope selection:

    • Perform detailed sequence alignment to identify regions of difference between human and Pan troglodytes MC1R

    • Prioritize regions with:

      • Multiple amino acid differences within a short stretch

      • Surface-exposed domains (N-terminus, extracellular loops, C-terminus)

      • Regions not conserved across other melanocortin receptors (MC2R-MC5R)

    • Avoid transmembrane domains and highly conserved intracellular regions

  • Peptide design strategy:

    • Generate species-specific peptides (15-25 amino acids) from selected regions

    • Consider adding carrier proteins (KLH, BSA) for small peptides

    • Design peptides with:

      • Terminal cysteine for directional conjugation

      • Proper secondary structure prediction

      • Minimal potential for aggregation

    • Create corresponding peptides from both species for comparative testing

  • Immunization and screening protocol:

    • Immunize animals distant from both target species (rabbits, mice, chickens)

    • Implement robust screening cascade:

      • Initial ELISA against immunizing peptides

      • Secondary screen against recombinant proteins

      • Counter-screen against the alternative species' MC1R

      • Cell-based assays with transfected receptors

      • Western blot under reducing and non-reducing conditions

      • Immunoprecipitation validation

  • Monoclonal antibody development considerations:

    • Generate hybridomas from immunized mice or implement phage display

    • Screen >1000 clones to identify those with desired specificity

    • Validate cross-reactivity with:

      • Recombinant proteins

      • Fixed and live cell immunocytochemistry

      • Flow cytometry

      • Immunohistochemistry on fixed tissues

  • Epitope mapping and validation:

    • Confirm exact epitopes using:

      • Alanine scanning mutagenesis

      • Hydrogen-deuterium exchange mass spectrometry

      • X-ray crystallography of antibody-peptide complexes

    • Test functional effects:

      • Interference with ligand binding

      • Impact on signaling

      • Effect on receptor trafficking

This strategic approach will generate antibodies with defined species specificity, allowing researchers to conduct comparative studies of human and Pan troglodytes MC1R expression, localization, and processing in mixed samples or parallel experiments .

What are the critical quality control parameters for ensuring functionality of recombinant Pan troglodytes MC1R in comparative receptor studies?

To ensure the functionality of recombinant Pan troglodytes MC1R in comparative receptor studies, researchers must implement these critical quality control parameters:

  • Structural integrity assessment:

    • SDS-PAGE and Western blotting:

      • Verify expected molecular weight (35-37 kDa)

      • Confirm glycosylation status (glycosylated receptor appears as diffuse band)

      • Monitor aggregation and degradation products

      • Compare migration pattern to human MC1R controls

    • Mass spectrometry analysis:

      • Confirm primary sequence and post-translational modifications

      • Identify any truncations or modifications

      • Verify disulfide bond formation

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy:

      • Confirm alpha-helical secondary structure (characteristic minima at 208 and 222 nm)

      • Compare thermal stability between human and chimpanzee receptors

      • Assess conformational changes upon ligand binding

    • Fluorescence-based thermal shift assays:

      • Determine melting temperature (Tm)

      • Compare stability in different detergents/lipid environments

      • Measure ligand-induced stabilization

  • Functional validation protocol:

    • Ligand binding assays:

      • Determine binding affinity (Kd) for α-MSH (target: 0.1-10 nM range)

      • Verify binding of antagonists (ASIP, β-defensin)

      • Compare binding parameters to human MC1R (within 2-fold)

    • G-protein coupling assessment:

      • Measure GTPγS binding upon receptor activation

      • Quantify EC50 for G-protein activation (target: 0.5-50 nM)

      • Confirm coupling to appropriate G-protein subtypes (Gαs)

    • Downstream signaling verification:

      • Assess cAMP production upon α-MSH stimulation

      • Measure ERK1/2 phosphorylation

      • Compare signal amplitudes and kinetics to human receptor

  • Cell-based functional parameters:

    • Surface expression quantification:

      • Flow cytometry with non-permeabilized cells

      • Surface biotinylation assays

      • Immunofluorescence microscopy (target: >60% surface localization)

    • Receptor internalization dynamics:

      • Measure rate and extent of agonist-induced internalization

      • Track receptor recycling kinetics

      • Compare trafficking to human MC1R variants

    • Downstream phenotypic effects:

      • Eumelanin/pheomelanin production ratio in melanocytes

      • Protection against UV-induced DNA damage

      • Changes in dendricity and melanin transfer capacity

  • Batch consistency requirements:

    • Establish acceptable ranges for critical parameters:

      • Protein yield (>0.5 mg/L culture)

      • Purity (>90% by silver stain)

      • Specific activity (>80% of theoretical maximum)

      • Stability (>80% activity after 1 week at 4°C)

    • Document complete characterization for each production batch

    • Include positive controls (human MC1R) in parallel testing

Implementing these rigorous quality control parameters ensures that any observed differences between human and Pan troglodytes MC1R in comparative studies reflect genuine biological differences rather than preparation artifacts .

What are the emerging technologies for studying MC1R function across species, including Pan troglodytes and human variants?

Emerging technologies are revolutionizing comparative MC1R research across species. Here's a comprehensive overview of cutting-edge approaches:

  • Cryo-electron microscopy (Cryo-EM) for structural insights:

    • Recent advances allow determination of GPCR structures at near-atomic resolution

    • Can capture MC1R in different conformational states (inactive, active, intermediate)

    • Enables visualization of species-specific structural differences

    • Facilitates structure-based drug design targeting specific MC1R variants

    • Current resolution capabilities: 2.5-3.5Å for GPCRs similar to MC1R

  • CRISPR-based genome editing and cellular models:

    • Base and prime editing for precise introduction of species-specific variants

    • CRISPR activation/interference (CRISPRa/CRISPRi) for modulating endogenous MC1R expression

    • CRISPR screening to identify species-specific regulators and interaction partners

    • Humanized/chimpanzeeized organoids with MC1R variants for 3D tissue-level comparisons

    • iPSC-derived melanocytes from diverse genetic backgrounds for personalized studies

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) for nanoscale localization of MC1R

    • Single-molecule tracking to monitor MC1R dynamics in live cells

    • FRET/BRET biosensors for real-time measurement of:

      • Receptor conformational changes

      • Protein-protein interactions

      • Second messenger production

    • Correlative light and electron microscopy (CLEM) to connect function with ultrastructure

  • Novel biochemical and biophysical approaches:

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to probe conformational dynamics

    • Native mass spectrometry for analyzing intact receptor complexes

    • Single-molecule force spectroscopy to measure ligand-receptor interactions

    • NanoBiT complementation assays for detecting protein interactions in live cells

    • Thermal proteome profiling to identify downstream effectors across species

  • Integrative computational methods:

    • Molecular dynamics simulations with enhanced sampling techniques

    • Deep learning approaches for predicting variant effects on structure/function

    • Systems biology modeling of the complete MC1R signaling network

    • Evolutionary sequence analysis using Bayesian phylogenetic frameworks

    • AlphaFold2/RoseTTAFold for accurate prediction of structural impacts of variants

These transformative technologies are enabling unprecedented insights into MC1R function across species, facilitating the development of targeted interventions for MC1R-associated disorders and a deeper understanding of pigmentation evolution in primates .

How can researchers design experiments to explore the potential role of Pan troglodytes MC1R in centromere integrity compared to human MC1R variants?

To systematically investigate differences in centromere integrity maintenance between Pan troglodytes MC1R and human MC1R variants, researchers should implement this comprehensive experimental design:

  • Cellular model establishment:

    • Generate isogenic melanocyte cell lines expressing:

      • Wild-type human MC1R

      • Human RHC variants (R151C, R160W, D294H)

      • Pan troglodytes MC1R

      • MC1R knockout controls

    • Use CRISPR/Cas9 gene editing to replace endogenous MC1R with species-specific variants

    • Verify equivalent expression levels via qRT-PCR and Western blotting

  • Centromere integrity assessment protocol:

    • Baseline metaphase chromosome analysis:

      • Prepare metaphase spreads using colcemid treatment

      • Quantify spontaneous centromeric abnormalities:

        • Centromere fragmentations

        • Premature centromere separations

        • Centromere duplications

      • Use CREST antibodies to specifically label centromeric proteins

    • UV challenge experiments:

      • Expose cells to physiologically relevant UV doses (50-100 J/m²)

      • Perform time-course analysis (2h, 6h, 12h, 24h post-UV)

      • Quantify centromeric abnormalities as above

      • Compare recovery kinetics between species variants

  • Centromere-specific molecular analysis:

    • Centromeric chromatin immunoprecipitation (ChIP):

      • Target centromeric proteins (CENP-A, CENP-B, CENP-C)

      • Measure association with α-centromeric satellite DNA

      • Compare stability of centromeric protein complex between variants

      • Assess potential MC1R colocalization with centromeric proteins

    • Centromere-associated protein quantification:

      • Immunofluorescence for key centromere proteins

      • Western blotting of chromatin fractions

      • Analyze centromere assembly factors (HJURP, Mis18)

      • Measure modifications of centromeric histones

  • Mechanistic pathway exploration:

    • α-MSH/cAMP signaling connection:

      • Measure pS435-ATR levels following α-MSH stimulation

      • Compare palmitoylation status of different MC1R variants

      • Assess rescue effects of forskolin and dbcAMP

      • Determine whether differences are dependent on MC1R trafficking vs. signaling

    • Advanced microscopy approaches:

      • Live-cell imaging with labeled centromere markers

      • Super-resolution microscopy of centromere ultrastructure

      • FRAP (Fluorescence Recovery After Photobleaching) to measure protein dynamics

      • Correlative light and electron microscopy for ultrastructural analysis

  • Functional consequences assessment:

    • Chromosome segregation analysis:

      • Live-cell imaging of mitotic progression

      • Quantification of segregation errors

      • Measurement of mitotic duration

      • Assessment of micronuclei formation

    • Genomic instability markers:

      • γH2AX foci formation

      • 53BP1 recruitment to damage sites

      • Micronuclei formation frequency

      • Chromosomal rearrangements

This comprehensive approach will reveal whether Pan troglodytes MC1R possesses enhanced capacity to maintain centromere integrity compared to human variants, potentially explaining differences in genomic stability and cancer susceptibility between species .

What experimental approaches should be used to investigate differences in MC1R palmitoylation between human variants and Pan troglodytes MC1R?

To systematically investigate differences in MC1R palmitoylation between human variants and Pan troglodytes MC1R, researchers should implement this comprehensive experimental approach:

  • Palmitoylation site prediction and conservation analysis:

    • Perform in silico analysis using CSS-Palm or similar algorithms

    • Compare predicted palmitoylation sites between:

      • Human wild-type MC1R

      • Human variant MC1Rs (R151C, R160W, D294H)

      • Pan troglodytes MC1R

    • Assess conservation of cysteine residues in C-terminal tail (particularly C315)

    • Generate sequence logos to visualize palmitoylation motif conservation across primates

  • Direct palmitoylation detection and quantification:

    • Metabolic labeling with palmitate analogs:

      • Incubate cells with 17-ODYA or alkyne-palmitate

      • Perform click chemistry to attach fluorescent/affinity tags

      • Visualize and quantify via in-gel fluorescence or Western blotting

      • Compare incorporation rates between species variants

    • Acyl-biotinyl exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC):

      • Block free thiols with N-ethylmaleimide

      • Cleave thioester bonds with hydroxylamine

      • Capture newly exposed thiols with biotin-HPDP

      • Enrich biotinylated proteins with streptavidin

      • Quantify MC1R by Western blotting

    • Mass spectrometry-based approaches:

      • Immunoprecipitate MC1R variants from cells

      • Perform site-specific mass spectrometry analysis

      • Identify exact residues modified

      • Quantify relative stoichiometry of modification at each site

  • Palmitoylation dynamics assessment:

    • Pulse-chase experiments:

      • Pulse with radiolabeled palmitate

      • Chase with non-labeled media

      • Measure turnover rates between variants

      • Determine half-life of palmitate modification

    • Palmitoylation cycle analysis:

      • Identify relevant DHHC palmitoyl transferases expressed in melanocytes

      • Measure association with MC1R variants using proximity ligation assays

      • Determine depalmitoylation rates using APT1/2 inhibitors

      • Compare kinetics between human and chimpanzee MC1R

  • Structure-function relationship studies:

    • Site-directed mutagenesis:

      • Generate C315A mutants in human and chimpanzee MC1R

      • Create chimeric receptors swapping C-terminal regions

      • Introduce potential novel palmitoylation sites

      • Assess impact on palmitoylation levels

    • Functional consequence evaluation:

      • Membrane microdomain localization (lipid raft association)

      • Trafficking efficiency to plasma membrane

      • G-protein coupling effectiveness

      • cAMP signaling capacity

      • α-MSH-induced internalization

      • UV-protection functions

  • Intervention studies:

    • Palmitoylation modulators:

      • Assess effects of 2-bromopalmitate (global inhibitor)

      • Test DHHC-specific inhibitors

      • Evaluate APT1/2 inhibitors to block depalmitoylation

      • Compare rescue effects between variants

    • Chemical chaperones and trafficking enhancers:

      • Test effects of 4-PBA, DMSO, glycerol

      • Evaluate impact on palmitoylation and function

      • Determine if palmitoylation enhancement rescues variant MC1R function

      • Compare rescue efficiency between human variants and chimpanzee MC1R

This comprehensive approach will reveal species-specific differences in MC1R palmitoylation patterns, dynamics, and functional consequences, potentially explaining differences in MC1R function and stability between humans and chimpanzees .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.