Recombinant Pan troglodytes Muscarinic acetylcholine receptor M2 (CHRM2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CHRM2; Muscarinic acetylcholine receptor M2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
VLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVI GYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAA AWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLY WHISRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP RDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIR IGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVT RTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNAT FKKTFKHLLMCHYKNIGATR
Uniprot No.

Target Background

Function

The muscarinic acetylcholine receptor M2 (CHRM2) mediates diverse cellular responses, including the inhibition of adenylate cyclase, phosphoinositide breakdown, and modulation of potassium channels via G protein coupling. Its primary transduction effect is adenylate cyclase inhibition. Signal transduction activates phospholipase C, releasing inositol trisphosphate (IP3), which subsequently triggers cytosolic calcium ion release.

Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is CHRM2 and what are its primary functions in neural systems?

The muscarinic acetylcholine receptor M2 (CHRM2) belongs to the G-protein-coupled receptor (GPCR) superfamily and plays crucial roles in neuronal excitability, synaptic plasticity, and feedback regulation of acetylcholine release . In both humans and chimpanzees, the CHRM2 receptor is involved in multiple signaling pathways that modulate neuronal activity. These receptors contribute to learning, memory, and cognitive processes through their role in cholinergic neurotransmission . When designing experiments with Pan troglodytes CHRM2, researchers should account for its involvement in these fundamental neural processes.

How conserved is CHRM2 between humans and chimpanzees?

CHRM2 is highly conserved between humans and chimpanzees due to their close evolutionary relationship. While the search results don't provide specific sequence homology data for Pan troglodytes CHRM2, researchers should note that functional domains, particularly those involved in ligand binding and G-protein coupling, demonstrate high conservation across primates. Experimental design should account for both the similarities and potential species-specific differences in receptor pharmacology and signal transduction pathways.

What expression systems are most effective for producing recombinant Pan troglodytes CHRM2?

Based on available protocols for human CHRM2, prokaryotic expression systems using E. coli have been successfully employed to produce recombinant CHRM2 protein fragments . When expressing Pan troglodytes CHRM2, researchers should consider:

  • Expression vector selection (vectors with His and TrxA tags have proven effective for human CHRM2)

  • Buffer optimization (PBS at pH 7.4 containing 0.01% SKL and 5% Trehalose has been used successfully)

  • Purification strategy (affinity chromatography leveraging His-tag is recommended)

  • Protein solubility considerations (membrane proteins like CHRM2 often require specialized solubilization methods)

For functional studies, mammalian expression systems may be more appropriate to ensure proper post-translational modifications and membrane insertion.

What are the recommended methods for verifying the identity and purity of recombinant Pan troglodytes CHRM2?

Multiple complementary approaches should be employed:

  • SDS-PAGE analysis: Expected molecular mass of approximately 40-45 kDa under reducing conditions, though actual band size may differ from predicted values due to post-translational modifications

  • Western blotting: Using antibodies specifically validated for CHRM2

  • Mass spectrometry: For precise molecular characterization and peptide fingerprinting

  • Functional assays: To confirm biological activity through ligand binding or signaling pathway activation

Researchers should note that discrepancies between predicted and observed molecular weight (as seen with human CHRM2 at 39.8 kDa predicted vs. 43 kDa observed) are common and may result from:

  • Alternative splicing

  • Post-translational modifications

  • Relative charge effects

  • Post-translational cleavage

How can researchers effectively design genotyping protocols for CHRM2 polymorphism studies in Pan troglodytes?

When designing genotyping protocols for Pan troglodytes CHRM2, researchers should:

  • Select appropriate SNPs based on conservation with human variants or chimpanzee-specific databases

  • Implement quality control measures including HWE testing (Hardy-Weinberg Equilibrium)

  • Consider linkage disequilibrium patterns when selecting tag-SNPs

  • Ensure high genotyping success rates (>95% as achieved in human studies)

For human CHRM2, researchers have successfully implemented SNPlex genotyping approaches with multiple markers across the gene . Similar strategies can be adapted for Pan troglodytes, with careful attention to species-specific sequence variations. Initial genotyping should focus on exons and regulatory regions that are most likely to affect gene function.

What are the optimal conditions for RT-PCR analysis of CHRM2 expression in Pan troglodytes brain tissue?

Based on protocols developed for human CHRM2, researchers should consider:

RT-PCR Protocol Recommendations:

  • Primer design targeting conserved regions between human and chimpanzee CHRM2

  • PCR conditions: 94°C for 1 min, 64°C for 1 min, and 72°C for 1 min, for 40 cycles, followed by a 10-min extension at 72°C

  • Optimization of primer concentration and cDNA input with verification via dissociation curves

  • Use of appropriate housekeeping genes (β-actin and HPRT have been effective for human studies)

When working with Pan troglodytes samples, tissue preservation and RNA extraction quality are critical factors affecting experimental success.

How can researchers investigate the multiple transcript variants of CHRM2 in Pan troglodytes brain tissue?

CHRM2 demonstrates complex transcriptional expression patterns with multiple promoters and transcript variants. In humans, at least six different mRNA transcripts (isoforms A-F) encoding the same receptor protein have been identified . To investigate these in Pan troglodytes:

  • Design primers targeting the unique exons of each transcript variant (similar to those used in human studies: FA&B, FC&D, FE&F with RA-F)

  • Perform PCR at 94°C for 30 sec, 55°C for 30 sec, and 72°C for 1:30 min, for 40 cycles, followed by a 7-min extension at 72°C

  • Verify specific amplification products on a 2% agarose gel

  • Consider quantitative RT-PCR to measure relative expression levels of each transcript

Understanding the distribution of transcript variants may provide insights into tissue-specific regulation of CHRM2 expression in chimpanzees, which could be compared with human expression patterns.

What approaches can be used to investigate the functional consequences of CHRM2 polymorphisms in Pan troglodytes?

Researchers investigating functional effects of CHRM2 variants should consider:

  • Gene expression correlation studies: Analyze correlation between SNP genotypes and CHRM2 mRNA levels in relevant tissues

  • Reporter gene assays: Construct reporter plasmids containing variant sequences to assess their impact on transcriptional activity

  • Electrophysiological studies: Evaluate effects on neuronal excitability in cellular models

  • Pharmacological characterization: Assess whether variants alter ligand binding or downstream signaling

Human studies have examined correlations between genetic variants and gene expression levels in brain tissue , providing a methodological framework that can be adapted for Pan troglodytes research.

How can researchers design experiments to compare the cognitive phenotypes associated with CHRM2 variants in humans and chimpanzees?

Designing comparative cognitive studies requires:

  • Selection of appropriate cognitive tasks: Choose tests that can be administered to both humans and chimpanzees with similar cognitive demands

  • Genotyping strategy: Target conserved polymorphisms shown to associate with cognitive phenotypes in humans

  • Statistical approach: Implement linear regression models testing for association between genotype and cognitive measures, controlling for relevant covariates

  • Cross-species validation: Compare results with published human findings on CHRM2 and intelligence

Human studies have demonstrated associations between CHRM2 variants and intelligence measures , providing potential targets for comparative research with chimpanzees.

What are common challenges in expressing recombinant Pan troglodytes CHRM2 and how can they be addressed?

Common challenges include:

  • Protein insolubility: As a membrane protein, CHRM2 may form inclusion bodies in prokaryotic systems. Solutions include:

    • Optimizing expression conditions (temperature, IPTG concentration)

    • Using solubility-enhancing tags (TrxA tag has shown success with human CHRM2)

    • Considering mammalian expression systems for functional studies

  • Molecular weight discrepancies: Like human CHRM2, Pan troglodytes CHRM2 may show differences between predicted and observed molecular weights. Researchers should:

    • Document both predicted (bioinformatic) and observed (experimental) values

    • Consider post-translational modifications specific to the expression system

    • Verify protein identity through multiple methods beyond size confirmation

  • Functional validation: Confirming proper folding and activity requires:

    • Ligand binding assays with known muscarinic agonists and antagonists

    • G-protein coupling assays

    • Second messenger quantification (e.g., calcium mobilization, cAMP inhibition)

How should researchers interpret conflicting results between in vitro and in vivo studies of CHRM2 function?

When confronted with discrepancies between in vitro and in vivo findings:

  • Consider system complexity: In vivo systems involve multiple receptor subtypes, compensatory mechanisms, and complex regulatory networks

  • Evaluate model validity: Assess whether the in vitro system adequately represents the physiological context

  • Examine species differences: Potential differences in signaling pathways or receptor pharmacology between humans and chimpanzees

  • Design validation experiments: Use multiple complementary approaches to confirm findings

Researchers should particularly consider the complex transcriptional regulation of CHRM2, with its multiple promoters and tissue-specific expression patterns , when interpreting conflicting results.

How do CHRM2 polymorphisms differ between humans and chimpanzees, and what are the functional implications?

While specific comparison data between human and chimpanzee CHRM2 polymorphisms is not provided in the search results, researchers can approach this question through:

  • Comparative genomic analysis: Identify polymorphic sites that are conserved or divergent between species

  • Functional prediction: Use in silico tools to predict effects of species-specific variants on protein function or expression

  • Experimental validation: Test functional differences using recombinant proteins or cell-based assays

Human studies have identified functional variants in non-coding regions (5'UTR, intronic regions) associated with cognitive phenotypes . Similar approaches can be applied to identify and characterize functional variants in Pan troglodytes CHRM2.

How can researchers use CHRM2 as a model to understand the evolution of cognitive traits in primates?

CHRM2 presents a valuable model for studying cognitive evolution because:

  • It has been consistently associated with cognitive abilities in humans

  • The cholinergic system is fundamental to learning and memory across species

  • Comparisons between closely related species can reveal selection pressures on cognitive mechanisms

Research approaches should include:

  • Comparative sequence analysis of regulatory regions

  • Cross-species phenotype-genotype associations

  • Functional characterization of species-specific variants

  • Analysis of expression patterns in homologous brain regions

Human studies showing associations between CHRM2 variants and intelligence provide a foundation for comparative studies investigating cognitive evolution in primates.

How can researchers investigate potential associations between Pan troglodytes CHRM2 variants and behavioral phenotypes?

Based on human research demonstrating associations between CHRM2 and externalizing behaviors , researchers can:

  • Define appropriate behavioral measures: Select behaviors that can be reliably assessed in chimpanzees

  • Implement a longitudinal design: Collect behavioral data across development, as done in human studies

  • Consider environmental moderators: Test for gene-environment interactions, similar to the parental monitoring interaction found with human CHRM2

  • Use appropriate statistical models: Implement linear regression models with genotype coded in an additive fashion (0, 1, or 2 copies of the major allele)

The statistical approach used in human studies, controlling for relevant covariates and testing for interaction effects , provides a methodological framework that can be adapted for chimpanzee research.

What gene-environment interactions involving CHRM2 have been identified in humans that might inform Pan troglodytes research?

Human studies have demonstrated that:

  • Parental monitoring moderates the association between CHRM2 and externalizing behavior

  • The association between CHRM2 genotype and externalizing behavior is stronger in environments with lower parental monitoring

  • There is evidence for a crossover effect, where genotypes associated with highest externalizing behavior under low monitoring show lowest levels under high monitoring

For Pan troglodytes research, analogous environmental factors might include:

  • Social group structure and hierarchy

  • Maternal care quality

  • Early life stress

  • Social enrichment in captive environments

When designing studies to investigate gene-environment interactions in chimpanzees, researchers should consider both measurement of environmental variables and appropriate statistical approaches to test interaction effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.