Recombinant Pan troglodytes Muscarinic acetylcholine receptor M3 (CHRM3)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The full-length sequence (1-590aa) features:

  • Extracellular N-terminal domain: Facilitates ligand interaction.

  • Seven transmembrane helices: Anchor the receptor in the plasma membrane.

  • Intracellular C-terminal domain: Mediates G protein coupling.

Key residues involved in acetylcholine binding (e.g., transmembrane domains 3, 5, and 6) are conserved across species, enabling cross-species functional studies .

G Protein Coupling

CHRM3 primarily activates Gq/11 proteins, triggering phospholipase C (PLC)-mediated inositol trisphosphate (IP3) and diacylglycerol (DAG) production . Recent studies indicate promiscuous coupling to Gi and Gs proteins, expanding its signaling repertoire .

Table 1: Key Research Applications

ApplicationExperimental Use
Ligand Binding AssaysCharacterize receptor interactions with agonists/antigens (e.g., tiotropium) .
Signal TransductionStudy Gq/11, Gi, and Gs pathways in heterologous systems .
Structural BiologyFacilitate crystallization for X-ray diffraction or cryo-EM studies .
Drug DevelopmentScreen therapeutics targeting asthma, cardiovascular diseases, or diabetes .

Functional Significance in Physiology

  • Smooth Muscle Regulation: Mediates bronchoconstriction and vasodilation via calcium mobilization .

  • Metabolic Control: Modulates insulin secretion in pancreatic β-cells .

  • Immune Modulation: Expressed in B and T cells, though exact roles remain under investigation .

Comparative Analysis with Human CHRM3

FeaturePan troglodytes CHRM3Human CHRM3
Amino Acid Identity>98%100% (reference)
G Protein SpecificityGq/11, Gi, GsGq/11 (primary), Gi/Gs (context-dependent)
Pathogenic MutationsNot reportedLinked to Eagle-Barrett syndrome

Technical Considerations

  • Expression Challenges: Low yield in E. coli due to hydrophobic transmembrane domains; detergent optimization required for solubilization .

  • Multimerization: Forms disulfide-linked dimers/trimers under non-reducing conditions, impacting functional assays .

Future Research Directions

  1. Structural Dynamics: Resolve conformational changes during ligand binding using cryo-EM .

  2. Allosteric Modulation: Explore ligands targeting transient binding sites identified via molecular dynamics .

  3. Species-Specific Signaling: Compare chimpanzee and human CHRM3 in disease models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRM3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MTLHSNSTTSSLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQZRQSVIFHKRAPEQAL
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates a variety of cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of CHRM3 in vascular systems?

CHRM3 (Muscarinic acetylcholine receptor 3) plays a critical role in vascular function through multiple mechanisms. Recent research has demonstrated that CHRM3 is localized to primary cilia of endothelial and cerebrovascular cells, where it contributes to mechanosensing and signal transduction . The receptor mediates various cellular responses including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through G protein actions . In vascular tissues, CHRM3 activation is linked to nitric oxide (NO) production, which is crucial for vasodilation and blood pressure regulation. Studies show that endothelial CHRM3 knockout results in increased blood pressure and attenuated acetylcholine-mediated vascular relaxation, highlighting its importance in maintaining vascular homeostasis . This receptor's activation enhances cilia length and sensory function specifically in terms of endothelial nitric oxide synthase (eNOS) activation, establishing a direct mechanistic link between CHRM3 signaling and vascular tone regulation.

How are recombinant Pan troglodytes CHRM3 proteins typically expressed and purified?

Recombinant Pan troglodytes CHRM3 proteins can be expressed using multiple expression systems depending on research requirements. According to available product information, researchers have successfully expressed CHRM3 in various systems including yeast, E. coli, baculovirus, and mammalian cells . Each expression system offers distinct advantages for particular research applications. For instance, E. coli systems provide high yield and cost-effectiveness but may present challenges for proper folding of complex membrane proteins like CHRM3. Alternatively, mammalian expression systems often provide more physiologically relevant post-translational modifications. Advanced expression strategies include biotinylation using AviTag-BirA technology, which enables covalent attachment of biotin to the AviTag peptide, facilitating downstream applications such as protein-protein interaction studies or immobilization . Purification typically involves affinity chromatography followed by size exclusion chromatography to obtain high-purity protein preparations suitable for structural studies or antibody production.

What antibodies are available for detecting CHRM3 in Pan troglodytes samples?

Several antibodies have been developed for CHRM3 detection, though researchers should carefully evaluate cross-reactivity with Pan troglodytes samples. Commercial antibodies like 21978-1-AP have demonstrated reactivity with human, mouse, and rat samples in Western blot applications . Due to the high sequence homology between human and chimpanzee CHRM3, many anti-human CHRM3 antibodies may cross-react with the chimpanzee protein. For instance, antibody ab167566 is suitable for Western blot applications with human samples and potentially with chimpanzee samples given the evolutionary conservation . When selecting antibodies for Pan troglodytes research, researchers should consider epitope conservation between species and validate antibody specificity through appropriate controls. Expected molecular weight for CHRM3 detection is approximately 60-66 kDa, which aligns with the predicted molecular weight of 66 kDa . Researchers working with Pan troglodytes samples should perform species validation before conducting extensive experiments.

How does CHRM3 localization to primary cilia impact its function in endothelial cells?

The recent discovery that CHRM3 localizes to primary cilia of endothelial cells represents a significant advancement in understanding this receptor's function. Primary cilia serve as important cellular mechanosensors, and the localization of CHRM3 to these structures provides insight into its mechanosensing capabilities . In cilialess cells, CHRM3 expression is downregulated, suggesting an interdependent relationship between cilia formation and CHRM3 expression . The functional significance of this localization is demonstrated by the fact that CHRM3 activation enhances cilia length and sensory function specifically related to eNOS activation. This implies that CHRM3 in primary cilia participates in sensing fluid shear stress and translating this mechanical signal into biochemical responses via NO production .

The ciliary localization of CHRM3 may explain its involvement in both vascular and cognitive functions, as primary cilia are known to regulate signaling cascades critical for vascular integrity, learning, and memory. The disruption of this ciliary localization could potentially contribute to the pathogenesis of hypertension and neurodegenerative conditions like Alzheimer's disease, where NO deficiency has been implicated in cerebral amyloid angiopathy through increased deposition of amyloid beta . This specialized localization suggests that targeting CHRM3 in primary cilia could represent a novel therapeutic approach for vascular and cognitive disorders.

What are the pathophysiological implications of CHRM3 dysfunction in vascular diseases and neurological disorders?

CHRM3 dysfunction has significant implications in both vascular diseases and neurological disorders. In vascular pathology, recent studies demonstrate that endothelial CHRM3 knockout leads to increased blood pressure and attenuated acetylcholine-mediated vascular relaxation . This suggests that CHRM3 signaling defects could contribute to hypertension development through reduced NO production and subsequent endothelial dysfunction. The vascular consequences of CHRM3 dysfunction extend beyond hypertension to potentially include cerebral amyloid angiopathy, which is associated with Alzheimer's disease (AD) .

In neurological contexts, endothelial CHRM3 knockout has been shown to result in altered fear behavior, establishing a link between vascular CHRM3 signaling and cognitive function . This supports the growing recognition of neurovascular coupling in brain health and disease. The pathophysiological role of CHRM3 may involve disruption of primary cilia function, which is critical for proper signaling cascades in both vascular integrity and cognition .

Additionally, CHRM3 has been implicated in various cancers, with amplified expression observed in colon, prostate, endometrial, and gastric tumors . In colon cancer specifically, post-CHRM3 signaling promotes cell growth through activation of epidermal growth factor receptors/ERK and protein kinase C/p38 mitogen-activated protein kinase (MAPK) signaling pathways . These findings collectively suggest that CHRM3 represents a potential therapeutic target for conditions ranging from hypertension and AD to certain types of cancer.

How do comparative differences in CHRM3 structure and function between humans and Pan troglodytes inform evolutionary neurobiology?

Comparative analysis of CHRM3 between humans and chimpanzees provides valuable insights into evolutionary neurobiology and potential species-specific adaptations in neurovascular function. While specific comparative data on CHRM3 function between these species is limited in current literature, the availability of recombinant Pan troglodytes CHRM3 enables detailed structural and functional studies . The high conservation of CHRM3 across primates suggests fundamental importance in physiological processes, while subtle differences may reflect species-specific adaptations.

Chimpanzee CHRM3 research can be contextualized within broader field studies of Pan troglodytes that have documented complex cognitive and social behaviors . These behavioral observations, combined with molecular studies of receptors like CHRM3, help elucidate the neurobiological underpinnings of primate cognition. The recent finding that endothelial CHRM3 knockout alters fear behavior in animal models underscores potential links between CHRM3 function and cognitive processes that may be relevant to evolutionary differences in human and chimpanzee behavior .

Researchers investigating evolutionary aspects of CHRM3 should consider employing comparative genomics, structural biology approaches, and functional assays to characterize species-specific variations. Pharmacological profiling of human versus chimpanzee CHRM3 could reveal subtle differences in ligand selectivity or downstream signaling that might contribute to species-specific neurovascular adaptations. Such studies would contribute significantly to understanding the evolutionary trajectory of cholinergic systems in primates.

What methodological approaches are optimal for studying CHRM3-mediated signal transduction in primary endothelial cilia?

Studying CHRM3-mediated signal transduction in primary endothelial cilia requires sophisticated methodological approaches that address the unique challenges of investigating this specialized cellular compartment. Researchers should consider the following integrated strategy:

Imaging Techniques:

  • Super-resolution microscopy (STORM, PALM) to precisely localize CHRM3 within the ciliary structure

  • Live-cell imaging combined with fluorescent CHRM3 constructs to track receptor dynamics

  • Proximity ligation assays to detect protein-protein interactions within cilia

Functional Assays:

  • Microfluidic systems to precisely control fluid shear stress on ciliated endothelial cells

  • Real-time NO detection using fluorescent indicators to measure CHRM3-activated eNOS activity

  • Calcium imaging to capture immediate signaling events following CHRM3 activation

Molecular Manipulations:

  • CRISPR-Cas9-mediated CHRM3 knockout or mutation specifically in endothelial cells

  • Ciliary targeting sequence modifications to alter CHRM3 localization

  • Optogenetic approaches to achieve temporally precise CHRM3 activation

Recent studies demonstrate that CHRM3 activation enhances cilia length and sensory function in terms of eNOS activation . Therefore, experimental designs should incorporate measurements of both ciliary morphology and downstream functional outcomes like NO production. The discovery that CHRM3 expression is downregulated in cilialess cells suggests bidirectional regulation , which necessitates careful experimental design to distinguish cause from effect when manipulating either CHRM3 or ciliary structures.

What are the optimal expression systems for producing functional recombinant Pan troglodytes CHRM3?

The choice of expression system for producing functional recombinant Pan troglodytes CHRM3 depends on research objectives and downstream applications. Multiple systems have been successfully employed with distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, potential inclusion body formationProtein fragment expression, structural studies of soluble domains
YeastModerate yield, some post-translational modifications, proper folding of membrane proteinsLess extensive glycosylation than mammalian systemsFunctional studies requiring properly folded protein, large-scale production
BaculovirusHigh expression levels, most post-translational modifications, proper protein foldingMore complex methodology, longer production timeStructural biology, antibody production, ligand binding studies
Mammalian cellsNative-like post-translational modifications, proper folding and traffickingLower yields, higher cost, more complex methodologySignaling studies, drug screening, applications requiring physiologically relevant modifications

For applications requiring biotinylated CHRM3, the AviTag-BirA technology can be implemented in E. coli systems, where BirA catalyzes the formation of an amide linkage between biotin and a specific lysine residue within the AviTag sequence . This approach facilitates downstream applications such as protein-protein interaction studies, pull-down assays, or surface immobilization for binding studies.

How can researchers effectively design experiments to elucidate the role of CHRM3 in neurovascular coupling?

Designing effective experiments to elucidate CHRM3's role in neurovascular coupling requires multidisciplinary approaches integrating vascular biology, neuroscience, and advanced imaging techniques. Based on recent findings linking endothelial CHRM3 to both vascular function and cognitive processes , researchers should consider the following experimental design strategy:

In Vitro Models:

  • Co-culture systems combining endothelial cells with neurons/astrocytes to recapitulate neurovascular units

  • Microfluidic devices with integrated electrical stimulation to assess activity-dependent vascular responses

  • Ciliated endothelial cell models to specifically study ciliary CHRM3 signaling

In Vivo Approaches:

  • Endothelial-specific CHRM3 conditional knockout models using Cre-loxP technology

  • Intravital microscopy to visualize real-time neurovascular responses in living animals

  • Behavioral testing coupled with vascular measurements to correlate vascular responses with cognitive outcomes

Molecular and Signaling Analysis:

  • Phosphoproteomic analysis to identify CHRM3-activated signaling networks

  • Transcriptomic profiling of endothelial cells following CHRM3 activation/inhibition

  • Proximity labeling approaches to identify CHRM3 interaction partners in vascular cells

The experimental approach should address the recent discovery that endothelial CHRM3 knockout not only affects vascular relaxation but also alters fear behavior . This suggests that researchers need to simultaneously assess both vascular and cognitive endpoints in their experimental designs. Moreover, since CHRM3 is localized to primary cilia in endothelial cells, experiments should incorporate ciliary function assessment, potentially using specialized reporters for ciliary signaling or techniques to manipulate ciliary structure.

What analytical methods are most effective for characterizing CHRM3-mediated signaling pathways across different cellular contexts?

Characterizing CHRM3-mediated signaling pathways across different cellular contexts requires sophisticated analytical approaches that can capture the complexity and context-dependency of CHRM3 signaling. Current research indicates that CHRM3 mediates various cellular responses including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through G proteins , while in cancer contexts, it promotes cell growth via EGFR/ERK and PKC/p38 MAPK pathways .

Recommended Analytical Methods:

  • Phosphoproteomics and Pathway Analysis:

    • Temporal phosphoproteomic profiling following CHRM3 activation

    • Bioinformatic pathway enrichment analysis to identify context-specific signaling nodes

    • Systems biology approaches to model pathway interactions and feedback mechanisms

  • Real-time Signaling Dynamics:

    • FRET-based biosensors for key second messengers (cAMP, IP3, Ca²⁺)

    • Genetically encoded kinase activity reporters

    • Single-cell imaging to capture signaling heterogeneity

  • Pathway Validation and Perturbation:

    • Pharmacological inhibitor panels targeting different pathway components

    • CRISPR screens to identify essential components of CHRM3 signaling

    • Synthetic biology approaches using engineered CHRM3 variants with altered coupling

  • Contextual Analysis:

    • Comparative signaling studies across endothelial, neuronal, and cancer cell types

    • Extracellular matrix variations to assess microenvironmental influences

    • 3D organoid cultures to model tissue-specific CHRM3 signaling

Given CHRM3's diverse functions across cell types, researchers should design experiments that systematically compare signaling dynamics between endothelial cells (where CHRM3 regulates NO production), neuronal contexts (relevant to cognitive function), and cancer cells (where CHRM3 promotes proliferation). Special attention should be given to primary cilia-localized CHRM3 signaling , which may involve unique signaling mechanisms distinct from plasma membrane CHRM3 populations.

How might CHRM3-targeted therapeutics be developed for treating conditions involving neurovascular dysfunction?

The development of CHRM3-targeted therapeutics for neurovascular dysfunction represents an emerging frontier based on recent discoveries linking CHRM3 to both vascular regulation and cognitive function. Recent research demonstrating that endothelial CHRM3 knockout leads to increased blood pressure and altered fear behavior provides a strong rationale for therapeutic exploration in conditions characterized by neurovascular dysfunction, such as hypertension and Alzheimer's disease.

Therapeutic Development Strategies:

  • Ciliary-Targeted Approaches:

    • Development of compounds specifically targeting CHRM3 in primary cilia

    • Nanocarrier systems designed to deliver drugs to ciliary compartments

    • Small molecules that modulate ciliary CHRM3 without affecting plasma membrane CHRM3

  • Pathway-Selective Modulators:

    • Biased agonists that preferentially activate NO-producing pathways

    • Allosteric modulators that enhance CHRM3-mediated vascular relaxation

    • Tissue-selective CHRM3 activators that preferentially target cerebrovascular beds

  • Gene Therapy Approaches:

    • Viral vector delivery of CHRM3 to endothelial cells

    • CRISPR-based enhancement of CHRM3 expression or signaling

    • mRNA therapeutics for transient CHRM3 upregulation

  • Combination Therapeutic Strategies:

    • CHRM3 modulators combined with ciliary function enhancers

    • Dual targeting of CHRM3 and downstream effectors like eNOS

    • Multimodal approaches addressing both vascular and neuronal aspects

The therapeutic potential of CHRM3 modulation must be balanced against potential side effects, given CHRM3's widespread expression and diverse functions. Careful consideration should be given to developing compounds with appropriate selectivity profiles that can enhance beneficial neurovascular signaling without triggering unwanted effects in other tissues. Additionally, since CHRM3 has been implicated in cancer progression , safety profiling of any CHRM3-targeted therapeutics must include thorough carcinogenicity assessment.

What are the comparative evolutionary implications of CHRM3 function between Pan troglodytes and humans in cognitive development?

The comparative study of CHRM3 function between Pan troglodytes and humans offers valuable insights into the evolution of cognitive capabilities in primates. While specific comparative data on CHRM3 between these species is limited, this research direction holds significant promise for understanding how cholinergic signaling may have contributed to human cognitive evolution.

Chimpanzee field studies have documented sophisticated behaviors including tool use, complex social interactions, and cultural learning , suggesting advanced cognitive capabilities that may share underlying molecular mechanisms with human cognition. The recent finding that endothelial CHRM3 affects fear behavior raises intriguing questions about whether species differences in CHRM3 structure or expression patterns might contribute to distinct cognitive phenotypes.

Potential approaches for investigating evolutionary aspects include:

  • Comparative Genomic Analysis:

    • Examination of regulatory regions controlling CHRM3 expression

    • Identification of human-specific variants in CHRM3 or its signaling partners

    • Analysis of selective pressure on CHRM3 during primate evolution

  • Functional Comparison:

    • Comparative pharmacological profiling of human versus chimpanzee CHRM3

    • Cross-species cell models expressing species-specific CHRM3 variants

    • Analysis of CHRM3 expression patterns in brain regions relevant to higher cognition

  • Developmental Studies:

    • Comparative analysis of CHRM3 expression during neurodevelopment

    • Investigation of ciliary CHRM3 in developmental neurovascular coupling

    • Induced pluripotent stem cell models from both species differentiated to neural lineages

The evolutionary significance of CHRM3 may extend beyond its direct signaling effects to include its localization to primary cilia, which regulate signaling cascades critical for vascular integrity and learning and memory . Species differences in ciliary function or CHRM3 ciliary localization could potentially contribute to the evolution of distinct cognitive capabilities in humans versus chimpanzees.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.