Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
NDUFA11; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; Complex I-B14.7; CI-B14.7; NADH-ubiquinone oxidoreductase subunit B14.7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-141
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGRLEGWEVFAKPKV
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed not to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone likely serving as the immediate electron acceptor.

Database Links

KEGG: ptr:739803

STRING: 9598.ENSPTRP00000054899

UniGene: Ptr.193

Protein Families
Complex I NDUFA11 subunit family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.

Q&A

What are the recommended storage conditions for recombinant NDUFA11?

Recombinant NDUFA11 requires specific storage conditions to maintain its stability and function. The protein should be stored at -20°C for short-term use, while long-term storage is recommended at either -20°C or -80°C . For active research, working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles . The protein is typically supplied in a glycerol-containing buffer (either liquid containing glycerol or a Tris-based buffer with 50% glycerol) . Importantly, repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity .

What methodology should be used to study NDUFA11's role in complex I assembly?

To investigate NDUFA11's role in complex I assembly, researchers should employ a multifaceted approach:

  • RNA interference (RNAi) or CRISPR-Cas9: Suppress NDUFA11 expression in cell lines (such as 143B cells) to observe effects on complex I assembly .

  • Blue Native (BN) gel electrophoresis: Essential for visualizing complex I and its subcomplexes. After NDUFA11 suppression, this technique can identify the accumulation of subcomplexes with molecular masses of approximately 815 kDa and 550 kDa .

  • Oxygen consumption measurement: Quantify cellular oxygen consumption linked to complex I function using platforms like Seahorse XF analyzers. NDUFA11 suppression has been shown to reduce oxygen consumption by approximately two-thirds .

  • Mitochondrial network analysis: Use fluorescence microscopy with MitoTracker to observe changes in mitochondrial morphology, as NDUFA11 deficiency can cause network fragmentation .

  • Stable Isotope Labeling of Amino Acids in Cell Culture (SILAC): This technique, combined with mass spectrometry, can identify proteins associated with incompletely assembled complex I in NDUFA11-deficient cells .

A comprehensive analysis should combine these approaches to establish both the structural and functional consequences of NDUFA11 alterations on complex I assembly and activity.

How can researchers study protein-protein interactions involving NDUFA11?

Investigating NDUFA11's protein interactions requires specific methodological approaches:

  • Co-immunoprecipitation (Co-IP): This is the gold standard for studying native protein interactions. For NDUFA11:

    • Extract natural proteins using appropriate extraction kits (e.g., Invent Biotechnologies SD-001/SN-002)

    • Incubate with antibodies against known interaction partners (e.g., anti-NDUFS1)

    • Analyze co-precipitated complexes by Western blot using anti-NDUFA11 antibodies

  • Protein-Protein Interaction (PPI) analysis: Computational approaches can predict interactions. Research has shown that while NDUFA11 and LRPPRC don't directly interact, they may be associated through NDUFS1 .

  • Complexome profiling: This technique combines blue native gel electrophoresis with mass spectrometry to map the composition of protein complexes across the gel. It's particularly valuable for identifying complex I assembly intermediates and determining where NDUFA11 fits in assembly pathways .

  • Western blotting for interaction validation: Use antibodies such as anti-NDUFA11 (Abclonal, A16239, 1:1000) for detection and quantification of interaction complexes .

When analyzing results, it's crucial to normalize pull-down protein levels obtained by Co-IP using IP protein bands of interaction partners like NDUFS1 to enable accurate comparison between experimental groups .

What experimental approaches are effective for studying NDUFA11's role in disulfidptosis and ischemic stroke?

To investigate NDUFA11's involvement in disulfidptosis and ischemic stroke (IS), researchers should implement the following methodology:

  • Gene expression analysis:

    • Use datasets like GSE16561 to screen for differentially expressed disulfidptosis-related biomarkers (DE-DRBs)

    • Apply bioinformatic tools to identify correlation patterns between NDUFA11 and other DE-DRBs

  • Machine learning models:

    • Develop support vector machine (SVM) models as optimal machine learning approaches for predicting IS based on NDUFA11 expression

    • Validate model accuracy using independent datasets such as GSE58294

  • Clinical validation:

    • Measure NDUFA11 expression in blood samples from IS patients compared to controls

    • Research has shown NDUFA11 expression levels in IS patients at approximately 20.9% of normal controls

  • In vitro/in vivo models:

    • Establish oxygen-glucose deprivation cell models and middle cerebral artery occlusion animal models of IS

    • Verify NDUFA11 expression changes and protein complex formations using Western blot and Co-IP

  • Protein complex analysis:

    • Specifically examine the NDUFS1-NDUFA11 complex formation, which has been shown to decrease in IS models

    • Quantify results using imaging software like ImageJ, normalizing to control proteins such as GAPDH

This multi-level approach enables comprehensive assessment of NDUFA11's specific role as a disulfidptosis-related biomarker in ischemic stroke pathophysiology.

How can researchers troubleshoot expression and purification issues with recombinant NDUFA11?

When encountering challenges with recombinant NDUFA11 expression and purification, researchers should systematically address these issues:

  • Expression system optimization:

    • NDUFA11 can be expressed in various systems including E. coli, yeast, baculovirus, or mammalian cells

    • For transmembrane proteins like NDUFA11, mammalian or insect cell systems often yield better folding and post-translational modifications

    • Adjust induction conditions (temperature, time, inducer concentration) to balance between yield and solubility

  • Solubilization strategies:

    • Due to NDUFA11's four transmembrane domains, use appropriate detergents for extraction

    • Start with milder detergents (DDM, LMNG) before trying stronger ones (SDS, Triton X-100)

    • Include glycerol (typically 10-50%) in buffers to maintain stability

  • Purification optimization:

    • If using tagged protein, ensure the tag doesn't interfere with folding (N vs. C-terminal tags may have different effects)

    • Implement multiple purification steps (affinity, ion exchange, size exclusion)

    • Maintain >90% purity for experimental applications

  • Storage and handling:

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

    • Monitor protein stability at 4°C for no more than one week

    • For long-term storage, flash-freeze aliquots and store at -80°C

  • Activity verification:

    • Assess proper folding through circular dichroism or limited proteolysis

    • Validate function through binding assays with known interaction partners like NDUFS1

    • Consider functional reconstitution in liposomes or nanodiscs for membrane proteins

If expression yields remain low, consider codon optimization for the expression system or fusion partners to enhance solubility.

How does NDUFA11 dysfunction contribute to mitochondrial disease pathogenesis?

NDUFA11 dysfunction contributes to mitochondrial disease through several mechanisms:

  • Disruption of complex I assembly:

    • NDUFA11 defects lead to accumulation of subcomplexes ranging from 550 kDa to 850 kDa

    • This results in reduced formation of fully assembled complex I and complex I-containing supercomplexes

    • In patient studies, particularly those with early-onset NDUFA11-related mitochondrial disease, this manifests as fatal encephalocardiomyopathy

  • Bioenergetic consequences:

    • Reduced complex I activity leads to compromised NADH oxidation and electron transport

    • This results in decreased proton pumping across the inner mitochondrial membrane

    • Consequently, ATP production via oxidative phosphorylation is impaired

  • Mitochondrial network alterations:

    • NDUFA11 suppression causes fragmentation of the mitochondrial network

    • This morphological change likely reflects broader mitochondrial dysfunction and stress response mechanisms

  • Molecular interactions:

    • NDUFA11 interacts with NDUFS1 and potentially other complex I components

    • Disruption of these interactions destabilizes complex I assembly pathways

    • In ischemic stroke models, decreased formation of NDUFS1-NDUFA11 protein complexes correlates with pathology

  • Tissue-specific effects:

    • While NDUFA11 is expressed in multiple tissues, defects manifest predominantly in high-energy tissues like the brain and heart

    • This tissue specificity must be considered when modeling NDUFA11-related diseases

Understanding these pathogenic mechanisms is essential for developing potential therapeutic strategies for mitochondrial diseases associated with NDUFA11 dysfunction.

What are the key considerations for designing studies comparing human and chimpanzee NDUFA11?

When designing comparative studies of human and chimpanzee NDUFA11, researchers should address these crucial methodological aspects:

  • Sequence and structure analysis:

    • Conduct detailed phylogenetic analyses to identify conserved and divergent regions

    • Map these differences onto structural models to predict functional implications

    • Consider that human NDUFA11 may have evolved under different selective pressures than chimpanzee NDUFA11, with humans showing more nonsynonymous polymorphisms in transmembrane regions

  • Expression system selection:

    • Express both proteins in identical systems to ensure valid comparisons

    • Consider using both homologous (species-matched) and heterologous expression systems

    • Document any differences in expression efficiency, which might reflect co-evolutionary adaptations with other cellular components

  • Functional assays:

    • Measure complex I activity in comparable cellular backgrounds

    • Use rescue experiments in NDUFA11-deficient cells from both species

    • Quantify oxygen consumption rates and ATP production with standardized methodologies

  • Interaction networks:

    • Compare protein-protein interactions using techniques like BioID or proximity labeling

    • Investigate whether species differences affect interactions with assembly factors like NDUFS1

    • Document differences in complex I assembly pathways between species

  • Mutational analysis:

    • Create equivalent mutations in both human and chimpanzee NDUFA11

    • Assess whether the same mutations have different phenotypic consequences

    • Consider the neutral theory of molecular evolution and potential departures from neutrality when interpreting results

This comprehensive approach enables valid cross-species comparisons while accounting for evolutionary and functional differences.

How should researchers design experiments to study NDUFA11's role in complex I assembly pathways?

Designing experiments to elucidate NDUFA11's precise role in complex I assembly requires a strategic approach:

  • Time-course assembly studies:

    • Use inducible expression systems to track complex I assembly in real-time

    • This addresses a significant knowledge gap, as most studies have examined static snapshots rather than dynamic assembly processes

    • Apply pulse-chase labeling to distinguish between assembly intermediates and degradation products

  • Systematic subunit analysis:

    • Create cell lines with controlled expression of NDUFA11 (from knockout to overexpression)

    • Compare with similar manipulations of other complex I subunits

    • This helps position NDUFA11 within the hierarchical assembly pathway

  • Assembly intermediate characterization:

    • Apply blue native electrophoresis combined with second-dimension SDS-PAGE

    • Use complexome profiling to identify composition of assembly intermediates

    • Particular attention should be paid to subcomplexes ranging from 550 kDa to 815 kDa that accumulate in NDUFA11-deficient cells

  • Assembly factor interactions:

    • Investigate interactions with known assembly factors (NDUFAF1–4, ACAD9, ECSIT, FOXRED1, TMEM126B)

    • Use proximity labeling techniques to identify transient interactions during assembly

    • Determine whether NDUFA11 influences recruitment of these factors to assembly intermediates

  • Modular assembly investigation:

    • Design experiments to determine how NDUFA11 affects assembly of distinct modules (N, Q, ND1, ND2, ND4, and ND5 modules)

    • Current evidence suggests NDUFA11 affects the membrane arm assembly of complex I

    • Investigate whether stalling occurs at specific assembly bottlenecks

This experimental framework will help resolve current contradictions in the literature regarding the precise role of NDUFA11 in complex I assembly.

What experimental controls are critical when studying NDUFA11 in disease models?

When investigating NDUFA11 in disease models, particularly ischemic stroke or mitochondrial disorders, these critical controls must be implemented:

  • Genetic background controls:

    • Use isogenic cell lines or animal models differing only in NDUFA11 status

    • For clinical samples, carefully match controls for age, sex, and relevant comorbidities

    • Consider using CRISPR-engineered revertant lines to confirm phenotype specificity to NDUFA11

  • Expression level validation:

    • Quantify NDUFA11 protein levels using validated antibodies (e.g., Abclonal, A16239)

    • Include appropriate loading controls (GAPDH is commonly used)

    • When analyzing patient samples, account for potential tissue-specific expression differences

  • Functional specificity controls:

    • Include parallel analyses of other complex I subunits to distinguish NDUFA11-specific effects

    • Measure multiple aspects of mitochondrial function (not just complex I activity)

    • Use specific inhibitors (rotenone for complex I) and substrates (duroquinol for complex III) to confirm pathway specificity

  • Model validation controls:

    • For ischemic models, verify extent of oxygen-glucose deprivation or vascular occlusion

    • Confirm disease phenotype using established biomarkers beyond NDUFA11

    • For in vitro models, demonstrate clinical relevance by comparison with patient data

  • Rescue experiments:

    • Reintroduce wild-type NDUFA11 to confirm phenotype reversibility

    • Use structure-based mutants to identify critical functional domains

    • Include heterologous complementation with orthologous proteins when relevant

Implementing these controls ensures that observed phenotypes are specifically attributable to NDUFA11 dysfunction rather than secondary effects or experimental artifacts.

How should researchers interpret contradictory data on NDUFA11's role in complex I assembly?

When faced with contradictory findings regarding NDUFA11's role in complex I assembly, researchers should apply these analytical principles:

By systematically analyzing contradictions through these lenses, researchers can develop more comprehensive models of NDUFA11 function that accommodate apparently conflicting observations.

What statistical approaches are most appropriate for analyzing NDUFA11 expression data in clinical samples?

When analyzing NDUFA11 expression data from clinical samples, these statistical approaches provide the most robust results:

  • Normalization strategies:

    • Use multiple reference genes (e.g., GAPDH) for normalization rather than a single housekeeping gene

    • Apply geometric mean normalization for RT-qPCR data

    • For proteomic data, consider total protein normalization or specialized approaches like SILAC

  • Appropriate statistical tests:

    • For comparing NDUFA11 expression between two groups (e.g., IS patients vs. controls), use:

      • Student's t-test for normally distributed data

      • Mann-Whitney U test for non-parametric distributions

    • For multiple group comparisons, employ ANOVA with appropriate post-hoc tests

    • Report effect sizes alongside p-values to indicate biological significance

  • Machine learning implementation:

    • Support Vector Machine (SVM) models have shown success for NDUFA11-based disease classification

    • Implement proper cross-validation to avoid overfitting

    • Validate models using independent datasets (as demonstrated with GSE58294 for ischemic stroke)

  • Correlation analyses:

    • When examining relationships between NDUFA11 and other biomarkers, calculate correlation coefficients

    • For normal distributions, use Pearson's correlation

    • For non-parametric data, apply Spearman's rank correlation

    • A significant positive correlation (coefficient = 0.513) has been observed between NDUFA11 and LRPPRC expression in IS

  • Multivariate approaches:

    • Principal Component Analysis (PCA) can identify patterns across multiple molecular markers

    • Cox regression for survival analysis in longitudinal studies

    • Adjust for confounding variables (age, sex, comorbidities) using multiple regression

These approaches maximize statistical power while minimizing false discoveries in clinical NDUFA11 research.

How can recombinant NDUFA11 be utilized in developing mitochondrial disease therapeutics?

Recombinant NDUFA11 offers several strategic applications in therapeutic development for mitochondrial diseases:

  • High-throughput screening platforms:

    • Develop assays using purified recombinant NDUFA11 to screen compound libraries

    • Design FRET-based interaction assays with partner proteins like NDUFS1

    • Identify molecules that stabilize NDUFA11 or promote its proper integration into complex I

  • Structure-based drug design:

    • Use recombinant NDUFA11 for structural studies (X-ray crystallography or cryo-EM)

    • Identify binding pockets that could be targeted by small molecules

    • Design peptide mimetics that could substitute for dysfunctional regions of mutant NDUFA11

  • Protein replacement strategies:

    • Develop delivery systems for recombinant NDUFA11 (liposomes, nanoparticles)

    • Engineer cell-penetrating peptide fusions to enhance mitochondrial targeting

    • Optimize protein stability for therapeutic applications using systematic mutagenesis

  • Biomarker development:

    • Utilize recombinant NDUFA11 to generate and validate highly specific antibodies

    • Develop quantitative assays to measure NDUFA11 levels in patient samples

    • Create standards for measuring complex I assembly status in diagnostic settings

  • Gene therapy vector validation:

    • Test expression and function of gene therapy constructs in NDUFA11-deficient models

    • Use recombinant protein as a positive control for functional assays

    • Develop reporter systems to monitor successful gene therapy intervention

These applications could advance treatment options for mitochondrial diseases associated with NDUFA11 dysfunction, including the reported fatal encephalocardiomyopathy .

What emerging technologies show promise for studying NDUFA11's role in disulfidptosis?

Several cutting-edge technologies offer new approaches to investigate NDUFA11's involvement in disulfidptosis:

  • Redox proteomics:

    • Apply cysteine-specific labeling techniques to identify redox-sensitive residues in NDUFA11

    • Quantify disulfide bond formation under glucose deficiency conditions

    • Map the disulfide proteome in NDUFA11-deficient versus normal cells

  • Live-cell redox imaging:

    • Develop NDUFA11 fusion constructs with redox-sensitive fluorescent proteins

    • Monitor real-time changes in protein oxidation status during ischemic conditions

    • Correlate NDUFA11 oxidation with mitochondrial function and cell death initiation

  • CRISPR-based screening:

    • Implement CRISPR activation/interference screens to identify genes that modify NDUFA11-related disulfidptosis

    • Create cell lines with engineered NDUFA11 cysteine mutations to assess their impact on disulfidptosis sensitivity

    • Develop pooled CRISPR screens for disulfidptosis modifiers in ischemic conditions

  • Single-cell multi-omics:

    • Apply single-cell transcriptomics, proteomics, and metabolomics to heterogeneous populations

    • Identify cell-specific responses to NDUFA11 dysfunction

    • Map trajectories of cell fate decisions during disulfidptosis progression

  • Spatial proteomics:

    • Implement proximity labeling techniques to map the NDUFA11 interaction network during disulfidptosis

    • Use multiplexed ion beam imaging (MIBI) or Imaging Mass Cytometry to visualize NDUFA11 complexes in tissue contexts

    • Correlate spatial distribution of NDUFA11 with markers of disulfidptosis in ischemic tissues

These technologies will help elucidate how NDUFA11 downregulation (observed at 20.9% of normal levels in IS patients) contributes to disulfidptosis-mediated neuronal injury .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.