Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFA13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Complex I-B16.6; CI-B16.6; NADH-ubiquinone oxidoreductase B16.6 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-144
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
AASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQ
IEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLI
GELYGLRTTEEALHASHGFMWYM
Uniprot No.
Target Background
Function
Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed not to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor. NDUFA13 plays a role in interferon/all-trans-retinoic acid (IFN/RA)-induced cell death, an apoptotic activity inhibited by interaction with viral IRF1. It also prevents transactivation of STAT3 target genes and may be involved in CARD15-mediated innate mucosal responses, regulating intestinal epithelial cell responses to microbes.
Database Links
Protein Families
Complex I NDUFA13 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side. Nucleus.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
