Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFB4; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4; Complex I-B15; CI-B15; NADH-ubiquinone oxidoreductase B15 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-129
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
SFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY
Uniprot No.

Target Background

Function

Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered its immediate electron acceptor.

Database Links

KEGG: ptr:460612

STRING: 9598.ENSPTRP00000026324

UniGene: Ptr.225

Protein Families
Complex I NDUFB4 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

Basic Research Questions

  • What is the structural composition of Pan troglodytes NDUFB4 and how does it compare to human NDUFB4?

NDUFB4 is a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the mitochondrial electron transport chain. Pan troglodytes NDUFB4 shows high sequence homology with human NDUFB4, reflecting their close evolutionary relationship.

When studying structural differences, researchers should:

  • Employ comparative sequence analysis using tools such as BLAST or Clustal Omega

  • Utilize protein modeling software (PyMOL, SWISS-MODEL) to predict structural variations

  • Consider X-ray crystallography or cryo-EM for definitive structural determination

Based on evolutionary analyses, the Pan troglodytes NDUFB4 protein is expected to maintain key functional domains similar to those in humans, particularly in regions involved in protein-protein interactions within complex I .

  • What expression systems are most effective for producing functional recombinant Pan troglodytes NDUFB4?

Multiple expression systems have been successfully employed for NDUFB4 production:

Expression SystemAdvantagesLimitationsTag Options
E. coliHigh yield, cost-effectiveMay lack post-translational modificationsHis, GST
Mammalian Cells (HEK293)Native-like folding and modificationsLower yield, higher costHis, Fc, Non-tagged
Cell-free systemsRapid production, avoids toxicity issuesRelatively expensiveMultiple options

Methodological approach:

  • For structural studies: E. coli expression with an N-terminal His-tag provides sufficient protein for crystallization attempts

  • For functional studies: HEK293 cells maintain native-like folding and post-translational modifications

  • For interaction studies: Consider dual-expression systems with potential binding partners

Research shows that incorporating membrane-mimicking environments during purification significantly improves stability of the recombinant protein .

  • What are the established methods for assessing NDUFB4 incorporation into functional complex I?

To evaluate proper incorporation of recombinant NDUFB4 into complex I:

  • Blue-native PAGE (BN-PAGE) with subsequent immunoblotting using anti-NDUFB4 or anti-complex I antibodies

  • Complex I enzyme activity assays:

    • NADH:ubiquinone oxidoreductase activity measurements

    • NADH oxidase staining of tissue sections

  • Proteoliposome reconstitution followed by functional assays

Methodological considerations:

  • Digitonin solubilization preserves supercomplexes better than other detergents

  • For BN-PAGE, concentration gradients (3-12%) offer optimal resolution

  • Activity assays should include controls for both CI-specific and CII-specific respiration

Recent research has shown that monitoring assembly intermediates can provide insights into the role of NDUFB4 in complex I biogenesis .

  • How is Pan troglodytes NDUFB4 typically stored and what are the optimal conditions for maintaining its stability?

For optimal storage and stability of recombinant NDUFB4:

  • Store at -20°C for short-term use; -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles; prepare working aliquots

  • For transmembrane proteins like NDUFB4, include appropriate detergents or lipids in storage buffers

Stability optimization strategies:

  • Buffer composition: 50 mM Tris-HCl pH 7.4, 150 mM NaCl, 10% glycerol, and mild detergent (0.05% DDM)

  • Addition of reducing agents (1-5 mM DTT or 0.5-2 mM TCEP) to prevent oxidation

  • Use of protease inhibitors in working solutions

Research indicates that His-tagged versions typically maintain activity for up to 6 months at -80°C, while shelf life at 4°C is limited to approximately one week .

Advanced Research Questions

  • What is the role of NDUFB4 in respiratory supercomplex formation and how can researchers effectively study these interactions?

NDUFB4 plays a critical role in mitochondrial respiratory supercomplex assembly, particularly in the formation of the I₁III₂IV₁ "respirasome." Research has identified specific residues within NDUFB4 that interact with UQCRC1 from complex III through hydrogen bonds .

Methodological approaches to study NDUFB4's role in supercomplex formation:

  • Site-directed mutagenesis:

    • Target key residues (Asn24, Arg30) involved in supercomplex formation

    • Assess effects on respirasome assembly using BN-PAGE

    • Measure functional consequences via respiratory flux analysis

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins to identify interacting partners

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional assessment:

    • Oxygen consumption rate (OCR) measurements using Seahorse technology

    • Complex I-specific vs. Complex II-specific OXPHOS respiration comparison

Research findings demonstrate that NDUFB4 point mutations (N24A and R30A) impair I₁III₂IV₁ respirasome assembly and reduce mitochondrial respiratory flux by 31% (resting), 24% (leak), and 40% (maximal) compared to wild-type controls .

  • How does evolutionary selection pressure on NDUFB4 compare between primates, and what methods can detect adaptive evolution?

Evolutionary analyses suggest NDUFB4 has experienced positive selection during primate evolution. Research has identified three potentially adaptive amino acid changes in NDUFB4: serine at position 12, glutamic acid at 16, and tyrosine at 96 .

Methodological approaches for detecting adaptive evolution:

  • Comparative genomic analysis:

    • Calculate non-synonymous (dN) and synonymous (dS) substitution rates using PAML

    • Perform Z-test for positive selection using MEGA

    • Reconstruct ancestral sequences at all tree nodes

  • Selection pressure mapping:

    • Categorize amino acid changes as poorly conserved, medium conserved, medium-highly conserved, or highly conserved

    • Identify periods of positive selection in evolutionary history

    • Map selection pressure to functional domains

  • Functional validation of evolutionary changes:

    • Site-directed mutagenesis of adaptively selected residues

    • Comparative functional assays between species variants

Research has shown that NDUFB4 exhibits evidence of positive selection at specific timepoints in primate evolution, particularly preceding the emergence of apes and following the emergence of orangutans .

  • What approaches can researchers use to study the interaction network of NDUFB4 with other complex I subunits?

NDUFB4 interacts with multiple proteins within complex I and potentially other respiratory complexes. Understanding these interaction networks requires multifaceted approaches:

  • Physical interaction mapping:

    • Crosslinking mass spectrometry (XL-MS) to identify neighboring residues

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid or mammalian two-hybrid screening

  • Structural biology approaches:

    • Cryo-EM of intact complex I with focus on NDUFB4 position

    • Molecular dynamics simulations of subunit interfaces

    • Hydrogen-deuterium exchange mass spectrometry

  • Functional interaction assessment:

    • Knockout/knockdown of NDUFB4 followed by proteomics analysis

    • Assembly intermediate characterization via BN-PAGE

    • Complementation studies with mutant variants

Published interaction data shows that NDUFB4 directly interacts with NDUFS4, NDUFS5, NDUFS3, NDUFA6, NDUFA9, NDUFA11, NDUFA12, TIMMDC1, and complex III subunit UQCRC1 .

  • How does NDUFB4 deficiency affect global cellular metabolism and what techniques can researchers employ to measure these changes?

NDUFB4 mutations that impair respirasome formation lead to widespread metabolic alterations:

  • Metabolomic approaches:

    • Targeted metabolomics for TCA cycle intermediates

    • Untargeted metabolomics to identify novel affected pathways

    • Stable isotope labeling to track metabolic flux

  • Bioenergetic assessment:

    • Real-time analysis of oxidative phosphorylation and glycolysis (Seahorse XF)

    • ATP/AMP ratio measurements using luciferase-based assays

    • Lactate/pyruvate ratio determination

  • Redox state evaluation:

    • Measurement of NADH/NAD+ ratios

    • ROS detection using fluorescent probes

    • Glutathione redox state assessment

Research indicates that NDUFB4 mutations (N24A, R30A) cause global decreases in citric acid cycle metabolites, particularly affecting NADH-generating substrates. Additionally, there is a metabolic shift from complex I-linked to complex II-linked respiration as a compensatory mechanism .

  • What methodologies are most effective for studying NDUFB4's role in mitochondrial disease models?

NDUFB4 dysfunction may contribute to mitochondrial diseases, particularly complex I deficiency. Researchers can investigate its role using:

  • Disease model development:

    • CRISPR/Cas9-mediated NDUFB4 knockout or knock-in of disease mutations

    • Patient-derived fibroblast or induced pluripotent stem cell (iPSC) studies

    • Conditional tissue-specific knockout animal models

  • Functional assessments:

    • High-resolution respirometry on isolated mitochondria

    • In vivo metabolic phenotyping (metabolic cages, glucose/insulin tolerance)

    • Histological and ultrastructural analysis of affected tissues

  • Therapeutic screening approaches:

    • Small molecule screens for complex I activity restoration

    • Gene therapy or mRNA delivery strategies

    • Metabolic bypass interventions

Research on related complex I subunits (particularly NDUFS4) shows promising results with genetic overexpression approaches improving cristae morphology, mitochondrial dynamics, and disease symptoms in diabetic kidney disease models .

  • How can researchers effectively study the effect of post-translational modifications on NDUFB4 function?

Post-translational modifications (PTMs) may regulate NDUFB4 function and complex I assembly. To investigate these:

  • PTM identification strategies:

    • Phosphoproteomic analysis using TiO₂ enrichment

    • Ubiquitylome analysis following tryptic digestion and K-ε-GG enrichment

    • Acetylome analysis using anti-acetyl lysine antibodies

  • Functional validation approaches:

    • Site-directed mutagenesis of modified residues (phospho-mimetic or non-modifiable)

    • Enzymatic manipulation of PTMs (phosphatase/kinase treatment)

    • Temporal analysis during complex I assembly/disassembly

  • Regulation studies:

    • Response to oxidative stress, hypoxia, or other cellular stressors

    • Kinase/phosphatase inhibitor screens

    • Interaction changes dependent on modification state

While specific PTM data for NDUFB4 is limited in the current literature, research on other complex I subunits suggests that phosphorylation and acetylation may regulate assembly, stability, and activity of the respiratory complexes, offering potential research directions for NDUFB4 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.