Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

What is the structure and function of NDUFB6 in mitochondrial complex I?

NDUFB6 is an accessory subunit of NADH:ubiquinone oxidoreductase (complex I), the largest of the five complexes in the electron transport chain. While not directly involved in catalysis, NDUFB6 is essential for electron transfer activity in the respiratory chain .

The protein has a characteristic L-shaped structure consisting of:

• A long, hydrophobic N-terminal transmembrane domain that spans the inner mitochondrial membrane

• A hydrophilic C-terminal domain that interacts with globular subunits of complex I

This highly conserved two-domain structure is critical for anchoring the NADH dehydrogenase complex to the inner mitochondrial membrane. The protein weighs approximately 15.5 kDa and consists of 128 amino acids in humans, with the Pan troglodytes version having high homology .

How does recombinant Pan troglodytes NDUFB6 compare to native protein in experimental applications?

Recombinant Pan troglodytes NDUFB6 provides several advantages over native protein isolation:

• Purity levels: Recombinant versions typically achieve ≥85% purity as determined by SDS-PAGE , allowing for more controlled experimental conditions compared to native protein isolation.

• Structural integrity: When properly expressed in systems like E. coli or yeast, the recombinant protein maintains the critical functional domains present in the native form .

• Experimental control: Recombinant production allows for specific modifications such as:

  • Addition of His-tags for purification

  • Coupling to magnetic beads for immunoprecipitation

  • Production of full-length (2-128 aa) or partial variants for domain-specific studies

The recombinant protein's AA sequence encompasses the full mature protein: TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH .

What are the optimal storage and handling conditions for recombinant Pan troglodytes NDUFB6?

Proper storage and handling are critical for maintaining recombinant NDUFB6 activity:

For NDUFB6 pre-coupled to magnetic beads, additional considerations apply:

• Store at 2-8°C

• Never freeze magnetic bead preparations

• Maintain in PBS buffer at approximately 10mg beads/mL

What experimental techniques are most suitable for studying NDUFB6's role in complex I assembly?

Several complementary approaches have proven effective for investigating NDUFB6's role in complex I assembly:

• Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

  • Allows visualization of intact complex I and assembly intermediates

  • Different detergents (digitonin, DDM, Triton X-100) can reveal various NDUFB6-containing complexes

  • Enables detection of assembly defects when NDUFB6 is mutated or absent

• Two-dimensional (2D) gel electrophoresis:

  • Combines BN-PAGE with SDS-PAGE to separate complex I subunits

  • Can track incorporation of specific subunits into assembly intermediates

  • Helpful for identifying stalled assembly complexes in NDUFB6-deficient cells

• Pulse-chase analysis with radiolabeled mitochondrial translation products:

  • Tracks the fate of newly synthesized complex I subunits

  • Can reveal whether NDUFB6 deficiency affects early or late assembly steps

  • Allows determination of subunit turnover rates in the absence of proper assembly

• Complementation analysis:

  • Transfection of wild-type NDUFB6 into deficient cells

  • Inducible expression systems allow for controlled restoration of NDUFB6 levels

  • Directly tests causality between NDUFB6 deficiency and complex I assembly defects

How can researchers effectively validate the functionality of recombinant NDUFB6 proteins?

Validating recombinant NDUFB6 functionality requires multiple approaches:

• Biochemical validation:

  • SDS-PAGE and Western blotting: Confirms protein size and immunoreactivity

  • Subcellular fractionation: Verifies proper mitochondrial localization

  • Carbonate extraction: Determines membrane association properties

  • Cross-linking mass spectrometry: Identifies interaction partners

• Functional validation:

  • Complementation of NDUFB6-deficient cells: The gold standard for functional validation

  • Complex I activity assays: Measurement of NADH:ubiquinone oxidoreductase activity

  • Oxygen consumption measurements: Assesses respiratory chain function

  • Mitochondrial membrane potential analysis: Evaluates the impact on proton pumping

• Interaction studies:

  • Yeast two-hybrid (Y2H) assays: Tests for direct protein-protein interactions

  • Co-immunoprecipitation: Confirms association with other complex I subunits

  • Immunocapture using coupled magnetic beads: Identifies binding partners

• Structural validation:

  • Circular dichroism: Confirms proper secondary structure

  • Limited proteolysis: Assesses folding and domain organization

  • Thermal shift assays: Evaluates protein stability

What is known about the interaction between NDUFB6 and other complex I subunits in assembly intermediates?

Recent research using cross-linking mass spectrometry (XL-MS) and yeast two-hybrid (Y2H) approaches has revealed specific interactions between NDUFB6 and other complex I components:

• Direct interaction with NDUFS8:

  • XL-MS data shows physical proximity between NDUFB6 and NDUFS8

  • Y2H assays confirm specific binding between NDUFB6 and NDUFS8

  • Surface patches identified by deep mutational scanning (DMS) are critical for this interaction

  • Alanine mutations in these surface patches disrupt NDUFB6-NDUFS8 binding

• Role in assembly intermediate progression:

  • NDUFB6 facilitates the incorporation of NDUFS8 into the Q module

  • Specifically mediates the transition from the 86 kDa to 125 kDa assembly intermediate

  • Loss of NDUFB6 causes assembly to stall at the 86 kDa intermediate

  • Overexpression of NDUFS8 can bypass NDUFB6 deficiency, confirming functional relationship

• Additional interactions:

  • NDUFB6 has been found to interact with TMBIM4, NDUFS5, NDUFS3, NDUFA6, NDUFA11, NDUFA12, and NDUFAF1

  • These interactions suggest NDUFB6 may function within a larger network of complex I assembly factors

This interaction network positions NDUFB6 as a key component in the early stages of complex I assembly, functioning as a chaperone-like factor that guides specific subunits into the growing complex.

How do genetic variants in NDUFB6 impact mitochondrial function and disease susceptibility?

Genetic variations in NDUFB6 have significant implications for mitochondrial function and disease:

• Age-dependent expression effects:

  • The rs629566 (A/G) polymorphism in the NDUFB6 promoter creates a potential methylation site

  • In young individuals, carriers of the G/G genotype show increased NDUFB6 expression

  • In elderly individuals, the same G/G genotype is associated with reduced NDUFB6 expression

  • This age-dependent effect is mediated by increased DNA methylation of the promoter region in elderly G/G carriers

• Impact on insulin sensitivity:

  • NDUFB6 expression levels correlate with insulin sensitivity

  • Elderly carriers of the rs629566 G/G genotype show reduced muscle NDUFB6 mRNA levels

  • The degree of DNA methylation negatively correlates with NDUFB6 expression

  • This suggests an epigenetic mechanism for age-related insulin resistance

• Physical activity response:

  • The rs540467 SNP modifies physical activity-mediated changes in:

    • Insulin sensitivity

    • Body composition

    • Liver fat estimates

  • Approximately 36% of people with type 2 diabetes fail to improve insulin sensitivity despite increasing physical activity

  • This non-response may be partly attributable to NDUFB6 polymorphisms

• Translational evidence from cellular models:

  • Silencing Ndufb6 in C2C12 myotubes reduces mitochondrial respiration

  • Ndufb6 knockdown prevents rescue from palmitate-induced insulin resistance after electronic pulse stimulation (EPS)

  • This provides mechanistic support for the role of NDUFB6 in exercise-induced metabolic improvements

What methodologies are most effective for studying the effects of NDUFB6 deficiency on mitochondrial complex I assembly?

Investigating NDUFB6 deficiency requires a multi-faceted approach:

• Cell model development:

  • CRISPR-Cas9 gene editing: For complete knockout or introduction of specific variants

  • siRNA/shRNA knockdown: For temporary reduction of NDUFB6 expression

  • Patient-derived fibroblasts: Providing naturally occurring deficiency models

  • Inducible expression systems: Allowing controlled restoration of NDUFB6 levels

• Protein complex analysis:

  • Blue Native PAGE: Separates intact complexes by size

  • Complexome profiling: Mass spectrometry-based quantification of protein complexes

  • In-gel activity assays: Measuring complex I activity in native gels

  • Supercomplex analysis: Assessing the impact on higher-order respiratory chain organization

• Mitochondrial function assessment:

  • High-resolution respirometry: Measures oxygen consumption rates

  • Seahorse XF analysis: Quantifies mitochondrial respiratory parameters

  • Fluorescence-based assays: Monitors mitochondrial membrane potential

  • ROS production measurement: Assesses secondary effects of complex I deficiency

• Genetic complementation strategies:

  • Viral vector-based gene delivery: Restores wild-type NDUFB6 expression

  • Stable transfection with inducible promoters: Controls timing and level of NDUFB6 expression

  • Rescue with interacting partners: Tests whether NDUFS8 overexpression bypasses NDUFB6 deficiency

These methodologies have revealed that NDUFB6 deficiency specifically affects the early stages of complex I assembly, with characteristic accumulation of the 86 kDa intermediate and reduced incorporation of NDUFS8 into higher molecular weight complexes.

How can deep mutational scanning be applied to study NDUFB6 function and pathogenic variants?

Deep mutational scanning (DMS) offers powerful insights into NDUFB6 function:

• Methodology implementation:

  • Create a library of thousands of NDUFB6 variants through saturation mutagenesis

  • Express these variants in NDUFB6-deficient cells

  • Measure fitness effects of each variant through growth competition assays

  • Sequence the pool before and after selection to quantify variant frequencies

  • Calculate fitness scores for each amino acid substitution

• Functional domain mapping:

  • DMS reveals functionally critical regions that are sensitive to mutations

  • For NDUFB6, this approach has identified:

    • Surface patches involved in protein-protein interactions

    • Structurally important residues for protein stability

    • Regions with high tolerance for mutation (functionally neutral)

• Clinical variant interpretation:

  • DMS provides empirical evidence for evaluating variant pathogenicity

  • Can serve as a diagnostic resource for aiding diagnosis of NDUFB6-related diseases

  • The approach has provided functional evidence for over 5,000 NDUFB6 variants

  • Seven novel pathogenic NDUFB6 variants have been validated through this approach

• Structure-function relationships:

  • DMS data can be mapped onto protein structures to identify:

    • Critical interaction interfaces

    • Allosteric communication pathways

    • Evolutionary constraints on specific residues

    • Potential therapeutic targeting sites

This systematic approach to variant characterization provides comprehensive insights into NDUFB6 function that traditional mutational studies cannot achieve, creating valuable resources for both basic research and clinical applications.

What are the current challenges and solutions in producing high-quality recombinant Pan troglodytes NDUFB6 for structural and functional studies?

Researchers face several challenges when producing recombinant NDUFB6:

• Expression system selection:

  • Challenge: NDUFB6 is a mitochondrial membrane-associated protein, making soluble expression difficult

  • Solutions:

    • E. coli systems work well for full-length expression (2-128 aa)

    • HEK293 cells provide superior post-translational modifications

    • Yeast expression offers a compromise between yield and proper folding

• Purification strategies:

  • Challenge: Maintaining native conformation during purification

  • Solutions:

    • His-tagging enables efficient purification while minimizing structural impact

    • Size exclusion chromatography helps separate correctly folded protein

    • Optimized detergents (mild non-ionic) help maintain native structure

• Functional validation:

  • Challenge: Confirming that recombinant NDUFB6 retains native activity

  • Solutions:

    • Complementation assays in NDUFB6-deficient cells

    • Interaction studies with known binding partners (NDUFS8)

    • Structural characterization compared to predicted models

• Application-specific modifications:

  • Challenge: Adapting recombinant NDUFB6 for specific experimental applications

  • Solutions:

    • Pre-coupling to magnetic beads (>200 pmol capacity/mg beads) for immunoprecipitation

    • Hydrophilic surface modifications for improved solubility

    • Storage in optimized buffers (PBS with glycerol) to maintain stability

By addressing these challenges, researchers can produce high-quality recombinant Pan troglodytes NDUFB6 suitable for advanced structural and functional studies, including crystallography, cryo-EM, and complex I assembly reconstitution experiments.