Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8), is an accessory subunit of mitochondrial Complex I, also known as NADH:ubiquinone oxidoreductase . Complex I plays a crucial role in the mitochondrial respiratory chain, facilitating the transfer of electrons from NADH to ubiquinone .

General Information

NDUFB8, also referred to as CI-ASHI or NDUFB8, is encoded by nuclear genes and imported into the mitochondria . It is a component of the mitochondrial membrane respiratory chain's Complex I . The protein is not believed to be directly involved in catalysis but is essential for maintaining the structure of Complex I, which ensures efficient cellular energy production .

Table 1: General Information of NDUFB8

PropertyDescription
NameNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
SynonymsASHI, CI-ASHI
FunctionAccessory subunit of mitochondrial Complex I; maintains complex structure for efficient energy production
LocationMitochondrion inner membrane
Associated DiseasesDeficiency of mitochondrial complex I, Leigh-like encephalomyopathy
Molecular Weight~19 kDa
Related ProcessesElectron transport chain, oxidative phosphorylation
InteractionsInteracts with other subunits of Complex I, such as NDUFS2, NDUFB9, and NDUFA6
HGNC FamilyMitochondrial respiratory chain complexes

Function and Mechanism

NDUFB8 is an accessory subunit of Complex I, which catalyzes the transfer of electrons from NADH to ubiquinone in the mitochondrial respiratory chain . While NDUFB8 is not directly involved in the catalytic activity of Complex I, it plays a vital role in maintaining the complex's structural integrity, which is essential for efficient electron transfer and energy production .

Clinical Significance

Defects in NDUFB8 can lead to deficiency of mitochondrial Complex I, resulting in severe conditions such as Leigh-like encephalomyopathy . Studies using immunofluorescent assays have shown that a loss of NDUFB8 immunoreactivity is observed in patients with mutations affecting nuclear-encoding structural subunits and assembly factors .

Table 2: Clinical Significance of NDUFB8

ConditionDescription
Complex I DeficiencyResult of mutations affecting nuclear-encoding structural subunits and assembly factors, leading to decreased NDUFB8 immunoreactivity
Leigh-like EncephalomyopathyA severe neurological disorder associated with mitochondrial dysfunction and Complex I deficiency

Interactions

NDUFB8 interacts with other subunits of Complex I, such as NDUFS2, NDUFB9, and NDUFA6 . These interactions are crucial for the proper assembly and function of the complex.

Research and Diagnostic Applications

NDUFB8 antibodies are utilized in various research applications, including Western blotting (WB), immunohistochemistry (IHC-P), immunocytochemistry/immunofluorescence (ICC/IF), and immunoprecipitation (IP) . Immunohistochemical (IHC) assays can be used to identify patients with Complex I defects of Mendelian origins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion during the development process.
Synonyms
NDUFB8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; Complex I-ASHI; CI-ASHI; NADH-ubiquinone oxidoreductase ASHI subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-186
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPLSWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links

KEGG: ptr:744716

STRING: 9598.ENSPTRP00000005010

UniGene: Ptr.451

Protein Families
Complex I NDUFB8 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the function of NDUFB8 in mitochondrial complex I?

NDUFB8 functions as an accessory subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). While NDUFB8 is not directly involved in the catalytic activity, it plays crucial roles in structural integrity and assembly of the complex . Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor .

Recent cryo-electron microscopy studies of mammalian respiratory supercomplexes have revealed that NDUFB8 (the human ortholog of bovine ASHI) encircles the core of Complex I and binds to ND5 in the proton pumping module . Furthermore, NDUFB8 contributes directly to the oligomerization of Complex I with Complexes III and IV in the formation of respiratory supercomplexes , highlighting its structural importance beyond mere complex I assembly.

How conserved is NDUFB8 between humans and Pan troglodytes?

NDUFB8 is highly conserved among vertebrates, including between humans and chimpanzees (Pan troglodytes) . While the search results don't provide direct sequence comparison between human and Pan troglodytes NDUFB8, research indicates significant conservation among vertebrates with lower conservation in insects and other animals, and rather poor conservation in fungi and plants . This high degree of conservation suggests functional importance of the protein structure.

The human NDUFB8 protein sequence consists of 186 amino acids , and the Pan troglodytes version would be expected to share very high homology (>98%) based on typical protein conservation between these species. Researchers should note that this conservation facilitates cross-species experimental approaches, including the potential use of human antibodies for detecting Pan troglodytes NDUFB8.

What methodologies can determine the functional domains of Pan troglodytes NDUFB8?

Determining functional domains requires a multi-faceted approach:

  • Sequence analysis and homology modeling: Using the known human NDUFB8 sequence (186 amino acids) as a template to identify conserved domains in Pan troglodytes NDUFB8.

  • Site-directed mutagenesis: Creating specific mutations in conserved regions to assess their impact on protein function and complex I assembly.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling methods to identify interaction partners.

  • Cryo-EM structural analysis: Leveraging recent advances in cryo-EM technology that have revealed NDUFB8's position in respiratory supercomplexes .

  • Complementation studies: Similar to those performed with human NDUFB8 variants, where wild-type NDUFB8 expression restored mitochondrial function in deficient cells .

What expression systems are optimal for producing recombinant Pan troglodytes NDUFB8?

Based on successful expression of human NDUFB8, several expression systems can be considered:

Expression SystemAdvantagesLimitationsApplications
Wheat germ extractCell-free system allowing expression of membrane proteins; used successfully for human NDUFB8 Limited post-translational modificationsSDS-PAGE, ELISA, Western blotting
Mammalian cells (HEK293, COS-7)Native folding and post-translational modificationsHigher cost, lower yieldFunctional studies, complementation assays
Bacterial systems (E. coli)High yield, cost-effectiveLimited post-translational modifications, potential for inclusion bodiesStructural studies after refolding
Baculovirus-insect cellsGood for complex proteins, higher yield than mammalian cellsMore complex than bacterial systemsFunctional and structural studies

The choice of expression system should align with research objectives. For structural studies, wheat germ extract has been successfully used for human NDUFB8 , while functional complementation studies have utilized lentiviral vectors for expression in human fibroblasts .

How can researchers assess the quality and functional integrity of recombinant NDUFB8?

Assessment of recombinant NDUFB8 quality and functionality requires multiple approaches:

  • Biochemical characterization:

    • SDS-PAGE analysis with Coomassie staining to verify size and purity

    • Western blotting with specific antibodies against NDUFB8

    • Mass spectrometry to confirm protein identity and post-translational modifications

  • Functional assays:

    • Complementation studies in NDUFB8-deficient cell lines (measuring rescue of complex I activity)

    • Complex I enzymatic activity measurements using isolated mitochondria

    • Microscale respirometry (Seahorse) to assess cellular respiration parameters

  • Structural integration:

    • Blue native gel electrophoresis to assess incorporation into complex I

    • Immunohistochemical staining to verify localization

    • Flow cytometry analysis with complex I-specific antibodies

What experimental challenges are specific to Pan troglodytes NDUFB8 studies?

While leveraging methods established for human NDUFB8, researchers should address these challenges:

  • Species-specific validation: Antibodies developed against human NDUFB8 require validation for cross-reactivity with Pan troglodytes protein.

  • Cell model selection: Developing appropriate cellular models that express Pan troglodytes mitochondrial proteins for functional studies.

  • Heterologous expression considerations: When expressing in non-chimpanzee cells, potential interactions with endogenous proteins from other species must be considered.

  • Complex I assembly dynamics: The assembly process may have subtle species-specific differences that affect experimental outcomes.

  • Post-translational modifications: Differences in post-translational modification patterns between species may affect protein function and should be characterized.

How does NDUFB8 contribute to respiratory chain complex formation and stability?

NDUFB8 plays multiple critical roles in complex I biology:

  • Structural support: NDUFB8 encircles the core of complex I and binds to ND5 in the proton pumping module, providing structural integrity .

  • Supercomplex formation: Recent cryo-EM studies revealed NDUFB8's direct contribution to the oligomerization of complex I with complexes III and IV (CI₁III₂IV₁) . This finding suggests that NDUFB8 serves as an interaction point between complexes.

  • Complex I stability: Mutations in NDUFB8 lead to reduced complex I levels as demonstrated by western blotting, blue native gel electrophoresis, and immunohistochemical staining , indicating its role in maintaining complex stability.

  • Assembly: While primarily considered an accessory rather than assembly factor, NDUFB8's absence affects the final assembly and stability of complex I.

To investigate these functions in Pan troglodytes NDUFB8, researchers can employ knockdown/knockout strategies followed by complementation with wild-type protein, similar to studies with human cells that demonstrated restoration of complex I activity after wild-type NDUFB8 expression .

How can researchers quantitatively assess NDUFB8's role in electron transport chain function?

Multiple complementary approaches provide robust assessment:

  • Isolated complex I activity measurements:

    • NADH:ubiquinone oxidoreductase activity in isolated mitochondria

    • Spectrophotometric assays measuring NADH oxidation rates

  • Cellular respiration analysis:

    • Microscale respirometry (Seahorse) to measure oxygen consumption rates (OCR)

    • Parameters to assess: basal respiration, maximal respiration, spare respiratory capacity, and ATP production

  • Membrane potential assessments:

    • JC-1 or TMRM fluorescent dyes to measure mitochondrial membrane potential

    • Flow cytometry quantification of potential changes

  • ROS production measurement:

    • MitoSOX or DCF-DA to measure mitochondrial reactive oxygen species

    • Important for understanding secondary effects of complex I dysfunction

  • Metabolic profiling:

    • Lactate production as an indicator of respiratory chain dysfunction

    • Metabolomics to assess broader metabolic consequences

Data from such assays should be collected both in wild-type and NDUFB8-deficient conditions, with subsequent complementation using recombinant protein to confirm specificity.

What human NDUFB8 variants cause disease, and how might this inform Pan troglodytes studies?

Human NDUFB8 mutations have been identified in patients with mitochondrial complex I deficiency, presenting with encephalomyopathic or cardiomyopathic features . Specific variants include:

VariantProtein ChangeEffect on Splicing/ProteinClinical PresentationRef
c.432C>Gp.Cys144TrpCreated new splice donor site, exon 4 skipping (40% of transcripts)Progressive encephalomyopathy, hypotonia, cardiac hypertrophy
c.184T>Cp.Tyr62HisMissense affecting conserved residueSimilar encephalomyopathic phenotype
c.189delAp.Glu63Aspfs*35Frameshift causing premature stopSimilar encephalomyopathic phenotype

Comparative studies between human and Pan troglodytes NDUFB8 could reveal:

  • Evolutionary conservation of disease-associated residues

  • Species-specific differences in complex I assembly or function

  • Potential compensatory mechanisms in non-human primates

  • Differential sensitivity to mutations at homologous positions

What methodologies best assess the phenotypic consequences of NDUFB8 dysfunction?

Based on human studies, effective methodologies include:

  • Biochemical assessments:

    • Isolated complex I activity measurements in affected tissues

    • Lactate levels in blood and cerebrospinal fluid

  • Imaging techniques:

    • Neuroimaging to detect progressive changes in basal ganglia, brain stem, or internal capsule

    • Brain atrophy assessment via MRI volumetry

  • Cellular phenotyping:

    • Fibroblast metabolic profiling

    • Muscle biopsy analysis for mitochondrial abnormalities

    • iPSC-derived neural and cardiac cells for tissue-specific phenotypes

  • Complementation studies:

    • Expression of wild-type NDUFB8 in deficient cells to confirm causality and rescue phenotypes

    • Cross-species complementation to assess functional conservation

  • Animal models:

    • Transgenic mice carrying equivalent mutations

    • Cell-based models using CRISPR/Cas9 editing

Human NDUFB8 mutations resulted in progressive disease with encephalomyopathic features including muscular hypotonia, cardiac hypertrophy, respiratory failure, failure to thrive, and developmental delay . These phenotypes provide a framework for assessing Pan troglodytes NDUFB8 dysfunction in model systems.

How can cryo-EM technologies be utilized to understand species-specific differences in NDUFB8 structure and function?

Cryo-EM has revolutionized our understanding of complex I structure, including NDUFB8's position and interactions. For Pan troglodytes studies:

  • High-resolution structural analysis:

    • Recent 4.0-Å cryo-EM structures of mammalian supercomplexes have revealed NDUFB8's position and interactions

    • Comparative cryo-EM of human and Pan troglodytes complex I could identify subtle structural differences

  • Conformational dynamics:

    • Time-resolved cryo-EM to capture different functional states of complex I

    • Analysis of NDUFB8 position during active catalysis versus resting states

  • Supercomplex architecture:

    • NDUFB8 contributes directly to supercomplex formation (CI₁III₂IV₁)

    • Species-specific differences in supercomplex assembly could be visualized

  • Mutation impact visualization:

    • Introduction of disease-causing mutations followed by structural analysis

    • Comparison with human mutant structures to assess differential impacts

  • Integration with computational approaches:

    • Molecular dynamics simulations based on cryo-EM structures

    • Prediction of species-specific interaction networks

What cutting-edge genetic approaches can advance NDUFB8 functional studies?

Modern genetic tools offer powerful approaches for NDUFB8 research:

  • CRISPR/Cas9 genome editing:

    • Generation of isogenic cell lines with NDUFB8 knockout

    • Introduction of specific mutations identified in human patients

    • Creation of tagged versions for localization and interaction studies

  • Single-cell transcriptomics:

    • Analysis of cell-specific responses to NDUFB8 dysfunction

    • Identification of compensatory pathways activated in different cell types

  • Proteomics approaches:

    • Proximity labeling (BioID, APEX) to identify NDUFB8 interaction partners

    • Quantitative proteomics to assess changes in complex I composition

    • Post-translational modification mapping

  • Humanized animal models:

    • Introduction of human/chimpanzee NDUFB8 variants into model organisms

    • Assessment of species-specific functional differences in vivo

  • iPSC disease modeling:

    • Generation of iPSCs from patients with NDUFB8 mutations

    • Differentiation into affected cell types (neurons, cardiomyocytes)

    • Comparison with engineered Pan troglodytes iPSCs with equivalent mutations

How can researchers investigate NDUFB8's role in mitochondrial dynamics and quality control?

NDUFB8 dysfunction likely impacts broader mitochondrial processes:

  • Mitochondrial network analysis:

    • Live-cell imaging of mitochondrial morphology in NDUFB8-deficient cells

    • Quantification of fusion/fission events and network parameters

  • Mitophagy assessment:

    • Monitoring mitophagy markers (PINK1, Parkin recruitment)

    • Measuring mitochondrial turnover rates using MitoTimer or pulse-chase approaches

  • Integrated stress response:

    • Analysis of mitochondrial-to-nuclear signaling

    • Transcriptional responses to NDUFB8 dysfunction

  • Metabolic adaptation:

    • Metabolic flux analysis to determine pathway rerouting

    • Assessment of compensatory upregulation of alternative energy production

  • Interspecies comparative studies:

    • Comparing human vs. Pan troglodytes cellular responses to NDUFB8 dysfunction

    • Identifying potential species-specific adaptive mechanisms

Implementation of these advanced approaches can provide comprehensive insights into both the fundamental biology of NDUFB8 and the pathological consequences of its dysfunction, with important implications for understanding mitochondrial disease mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.