Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2) is a vital protein component of mitochondrial Complex I, also known as NADH: ubiquinone oxidoreductase . Encoded by the nuclear NDUFC2 gene, this protein is essential for the assembly, stability, and activity of Complex I, which is the first and largest enzyme complex of the mitochondrial oxidative phosphorylation (OXPHOS) system . Complex I plays a crucial role in cellular energy production by catalyzing the transfer of electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane, contributing to the proton gradient that drives ATP synthesis .

Structure and Function

NDUFC2 is a membrane protein located in the inner mitochondrial membrane, specifically assigned to the ND2 module within the proton-pumping modules of Complex I . It interacts with 12 other subunits, including those in the ND1, ND2, and ND4 modules, which is crucial for Complex I assembly and stability .

  • Role in Complex I Assembly: NDUFC2 plays an essential role in the assembly of the membrane arm of Complex I . Studies have shown that loss of NDUFC2 leads to concurrent loss of its associating subunits, particularly those of the ND1 and ND2 modules, causing a stall in Complex I assembly .

  • Functional Significance: NDUFC2 is critical for the proper functioning of Complex I, which is a major site of reactive oxygen species (ROS) generation within the mitochondria . Dysfunction of Complex I due to NDUFC2 deficiency can increase mitochondrial ROS production and lead to aberrant mitochondrial morphology .

Clinical Significance

Defects in NDUFC2 have been implicated in a range of human diseases, highlighting its clinical importance .

Research Findings

Multiple studies have highlighted the importance of NDUFC2 in mitochondrial function and its association with various diseases.

  • Mitochondrial Dysfunction: Research indicates that NDUFC2 deficiency leads to marked mitochondrial dysfunction, increased ROS generation, and mitochondrial damage .

  • Complex I Assembly Intermediates: Complexome analysis reveals that loss of NDUFC2 results in the accumulation of specific aberrant Complex I assembly intermediates, stalling the assembly process .

  • Gene Expression: Studies have shown that NDUFC2 gene expression is decreased in certain cancers, such as papillary thyroid carcinoma, suggesting its role as a potential diagnostic or therapeutic target .

  • Animal Models: Experiments using Ndufc2-knockout HEK293T cells and rat models have provided insights into the effects of NDUFC2 deficiency on mitochondrial structure and function .

NDUFC2 and Complex I Supercomplexes

  • NDUFC2 affects the formation of Complex I-containing supercomplexes. When NDUFC2 is deficient, other OXPHOS complexes (Complexes III and IV) remain as individual complexes or smaller supercomplexes without Complex I .

NDUFC2 and the ND2 Module

NDUFC2 is a component of the ND2 module and is essential for its assembly. The absence of NDUFC2 leads to the instability or defective assembly of the ND1 and ND2 modules, indicating that these modules do not preassemble independently .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFC2; NADH dehydrogenase [ubiquinone] 1 subunit C2; Complex I-B14.5b; CI-B14.5b; NADH-ubiquinone oxidoreductase subunit B14.5b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPVATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links

KEGG: ptr:451445

STRING: 9598.ENSPTRP00000007076

UniGene: Ptr.505

Protein Families
Complex I NDUFC2 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is NDUFC2 and its primary function in mitochondrial biology?

NDUFC2 (NADH dehydrogenase [ubiquinone] 1 subunit C2) functions as an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). While not directly involved in catalysis, NDUFC2 is essential for the proper assembly of Complex I, which serves as the entry point for electrons into the respiratory chain. Complex I transfers electrons from NADH to ubiquinone, with NDUFC2 specifically contributing to the formation of the membrane arm of the complex . The protein is also known as Complex I-B14.5b (CI-B14.5b) or NADH-ubiquinone oxidoreductase subunit B14.5b in scientific literature .

Research has demonstrated that disruption of NDUFC2 leads to altered Complex I assembly and activity, reduced mitochondrial membrane potential, decreased ATP production, and increased reactive oxygen species (ROS) generation, highlighting its fundamental importance in maintaining proper mitochondrial function .

What methods are used to measure NDUFC2 expression in experimental settings?

Several validated methods are employed to quantify NDUFC2 expression in research settings:

  • Reverse Transcription Polymerase Chain Reaction (RT-PCR): For mRNA expression analysis, researchers typically use SYBR Green PCR Master Mix for quantitative RT-PCR. The protocol includes an initial denaturation step of 94°C for 10 minutes followed by 40 cycles of 94°C for 15 seconds and 60°C for 15 seconds. Standards, samples, and negative controls are analyzed in triplicate, with results normalized to β-actin expression .

  • Western Blotting: For protein detection, anti-NDUFC2 rabbit polyclonal antibodies (such as Novus Biologicals NBP1-59610, used at 1:200 dilution) or monoclonal antibodies like EPR16499 are employed. Samples are typically separated by SDS-PAGE, transferred to PVDF membranes, and visualized using standard immunoblotting procedures .

  • Flow Cytometry: Intracellular staining protocols using specific anti-NDUFC2 antibodies can assess NDUFC2 expression at the single-cell level .

  • Immunohistochemistry: Paraffin-embedded tissue sections can be analyzed using specific antibodies to visualize NDUFC2 distribution in tissues .

What model systems are commonly used to study NDUFC2 function?

Researchers employ several complementary model systems to investigate NDUFC2 function:

  • Cell Culture Models: Human and mammalian cell lines (particularly fibroblasts) maintained in DMEM with 10% FBS, 1% L-glutamine, and antibiotics at 37°C and 5% CO₂ serve as primary in vitro models. Cells are typically passaged upon reaching confluence and used between the 10th-15th passage at approximately 70% confluence .

  • Genetic Knockout/Knockdown Models: siRNA or shRNA approaches targeting NDUFC2 in cell culture, or CRISPR-Cas9-mediated knockout models allow for functional investigation of NDUFC2 deficiency .

  • Rat Models: The stroke-prone spontaneously hypertensive rat (SHRSP) has been used as an animal model to study the contribution of NDUFC2 to stroke susceptibility, with feeding regimens including Japanese-style stroke-permissive diet (JD) to induce phenotypes .

  • Patient-Derived Fibroblasts: Primary skin fibroblasts from patients with confirmed pathogenic NDUFC2 variants provide crucial insights into the pathophysiological consequences of NDUFC2 dysfunction in humans .

What methodologies are most effective for studying NDUFC2-related Complex I assembly defects?

Multiple complementary approaches have proven effective for investigating NDUFC2-related Complex I assembly defects:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact protein complexes and can identify assembly intermediates. Patient-derived fibroblasts with NDUFC2 mutations show characteristic patterns of Complex I assembly defects when analyzed by BN-PAGE .

  • Complexome Profiling: This advanced proteomics approach combines BN-PAGE with mass spectrometry to generate a comprehensive profile of protein complex assembly states. In NDUFC2-deficient samples, complexome profiling reveals specific aberrant Complex I assembly intermediates, particularly those involving the ND2 module. This technique is especially valuable for identifying which assembly steps are affected by NDUFC2 deficiency .

  • Lentiviral Complementation Assays: Transduction of patient-derived fibroblasts with wild-type NDUFC2 using doxycycline-inducible lentiviral vectors provides a powerful approach to confirm variant pathogenicity. Successful rescue of Complex I assembly demonstrates a causal relationship between NDUFC2 deficiency and observed phenotypes .

  • Biochemical Enzyme Assays: Spectrophotometric assays measuring NADH:ubiquinone oxidoreductase activity provide quantitative assessment of Complex I function in isolated mitochondria or tissue homogenates .

How do variants in NDUFC2 affect Complex I assembly and function?

Research utilizing complexome profiling has elucidated specific mechanisms by which NDUFC2 variants disrupt Complex I assembly:

  • Accumulation of Assembly Intermediates: NDUFC2-deficient cells accumulate characteristic assembly intermediates, including:

    • Q module intermediates (~300 kDa) containing NDUFA5, NDUFS2, NDUFS3, NDUFS7, NDUFS8, NDUFAF3, and NDUFAF4 .

    • Larger intermediates (715-800 kDa) containing the Q module plus NDUFA13, TIMMDC1, ACAD9, ECSIT, NDUFAF1, and TMEM126B .

    • Preassembled ND4 modules with TMEM70 and FOXRED1 .

  • Functional Consequences: These assembly defects lead to:

    • Decreased Complex I activity

    • Reduced mitochondrial membrane potential

    • Diminished ATP production

    • Increased ROS generation

    • Elevated oxidative stress markers

    • Activation of inflammatory pathways (including NF-κB, MAPK p38, and JNK1)

  • Supercomplexes Disruption: NDUFC2 deficiency significantly reduces the formation of respiratory chain supercomplexes containing Complex I. While other OXPHOS complexes (III and IV) remain intact, they form smaller supercomplexes lacking Complex I rather than higher molecular weight supercomplexes .

What experimental approaches can validate pathogenicity of novel NDUFC2 variants?

A multi-tiered approach is recommended to establish pathogenicity of novel NDUFC2 variants:

  • Genetic Analysis:

    • Segregation analysis in families using Sanger sequencing

    • Variant frequency assessment in population databases (e.g., gnomAD)

    • In silico prediction tools to evaluate variant impact

  • Functional Validation:

    • Western blot analysis to assess NDUFC2 protein levels

    • BN-PAGE to evaluate Complex I assembly

    • Enzyme activity assays to measure Complex I function

    • Assessment of additional Complex I subunits (NDUFB8, NDUFA9, NDUFV1) by immunoblotting

  • Rescue Experiments:

    • Transduction of patient-derived fibroblasts with wild-type NDUFC2 using inducible lentiviral vectors

    • Doxycycline-induced expression of wild-type NDUFC2

    • Evaluation of Complex I assembly and subunit expression after rescue

The table below summarizes findings from rescue experiments in two patients with different NDUFC2 variants:

ParameterSubject 1 (c.346_*7del)Subject 3 (c.173A>T)Control
NDUFC2 protein (uninduced)UndetectableMinimalNormal
NDUFC2 protein (after induction)IncreasedIncreasedN/A
Complex I subunitsPartial increaseGreater increaseNormal
Complex I assemblyPartial rescueSignificant rescueNormal
Complexome profileLoss of supercomplexesSome supercomplexesNormal pattern

How can complexome profiling be used to understand NDUFC2's role in Complex I assembly?

Complexome profiling represents a powerful technique for elucidating NDUFC2's specific role in Complex I assembly by mapping the accumulation of assembly intermediates in NDUFC2-deficient samples:

  • Methodological Approach:

    • Mitochondrial samples are separated by BN-PAGE

    • Gel lanes are cut into equal slices

    • Proteins in each slice are digested and identified by mass spectrometry

    • Migration profiles of each protein are created and clustered to identify assembly intermediates

  • Key Findings from NDUFC2-Deficient Samples:

    • Q module assembly appears unaffected

    • Assembly stalls after incorporation of the Q module with NDUFA13 and TIMMDC1

    • The mitochondrial Complex I assembly complex (MCIA) components (ACAD9, ECSIT, NDUFAF1, TMEM126B) accumulate with the Q intermediate

    • Pre-assembled ND4 modules with TMEM70 and FOXRED1 accumulate but fail to integrate into the holoenzyme

  • Implications:

    • NDUFC2 plays a crucial role specifically in the assembly of the membrane arm of Complex I

    • Its primary function involves facilitating the incorporation of the ND2 module

    • Without functional NDUFC2, Complex I assembly stalls at characteristic points, preventing formation of the complete holoenzyme

This detailed mapping of assembly intermediates provides insights into the step-by-step process of Complex I assembly and identifies the precise stages where NDUFC2 function is required.

What is the relationship between NDUFC2 variants and human disease?

Research has established relationships between NDUFC2 variants and two distinct human pathologies:

  • Early-Onset Leigh Syndrome:

    • Bi-allelic pathogenic variants in NDUFC2 cause a severe neurodegenerative disorder characterized by developmental regression, elevated lactate, and characteristic neuroimaging abnormalities

    • Two confirmed pathogenic variants: c.346_*7del (p.His116_Arg119delins21) and c.173A>T (p.His58Leu)

    • Biochemical phenotype: severe isolated Complex I deficiency

    • Clinical features: developmental delay, regression, elevated lactate, and Leigh syndrome neuroimaging findings

  • Early-Onset Ischemic Stroke:

    • The T allele variant at NDUFC2/rs11237379 is associated with reduced gene expression and increased early-onset ischemic stroke risk (OR=1.39; CI, 1.07–1.80; P=0.012)

    • Combined TT/rs11237379 and A allele at NDUFC2/rs641836 further increases stroke risk (OR=1.56; CI, 1.14–2.13; P=0.006)

    • Mechanistic basis: Complex I dysfunction leads to mitochondrial dysfunction, oxidative stress accumulation, and increased cell vulnerability

This dual disease association highlights NDUFC2's critical role in mitochondrial function across multiple tissues and physiological contexts.

What are the optimal storage and handling conditions for recombinant NDUFC2?

Proper storage and handling of recombinant Pan troglodytes NDUFC2 is essential for maintaining protein integrity and experimental reliability:

  • Storage Recommendations:

    • Stock solution: -20°C for short-term storage; -80°C for extended preservation

    • Working aliquots: 4°C for up to one week

    • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

    • Avoid repeated freeze-thaw cycles, as this can lead to protein degradation

  • Quality Control Considerations:

    • Verify protein integrity by SDS-PAGE before experimental use

    • Use positive controls (commercially available NDUFC2) in immunoblotting experiments

    • Confirm antibody specificity using appropriate controls, including NDUFC2-knockout samples

    • Evaluate protein activity and folding using appropriate functional assays when necessary

How can researchers distinguish between pathogenic and benign NDUFC2 variants?

Distinguishing pathogenic from benign NDUFC2 variants requires a comprehensive analytical approach:

  • Population Frequency Analysis:

    • Check variant frequency in gnomAD and other population databases

    • Pathogenic variants are typically rare or absent in healthy control populations

    • No healthy controls in gnomAD are homozygous for loss-of-function NDUFC2 variants

  • Multi-tier Functional Assessment:

    • Measure NDUFC2 protein levels in patient samples

    • Evaluate Complex I assembly and activity

    • Assess mitochondrial membrane potential and ATP production

    • Measure ROS production and oxidative stress markers

    • Analyze inflammatory pathway activation

  • Complementation Studies:

    • Transduce patient-derived cells with wild-type NDUFC2

    • Quantify restoration of:

      • NDUFC2 protein expression

      • Complex I subunit levels (NDUFB8, NDUFA9, NDUFV1)

      • Complex I assembly

      • Complex I activity

The degree of rescue following wild-type NDUFC2 expression provides strong evidence for variant pathogenicity and can differentiate between variants causing partial vs. complete loss of function.

What controls should be included when studying NDUFC2 in complex experimental designs?

Robust experimental design for NDUFC2 studies should include several types of controls:

  • Genetic Controls:

    • Wild-type cells/tissues (positive control)

    • Known pathogenic NDUFC2 variant carriers (disease control)

    • Heterozygous carriers (carrier control)

    • Variants in other Complex I subunits (specificity control)

  • Experimental Controls:

    • Empty vector controls for transfection/transduction experiments

    • Non-targeting siRNA for knockdown studies

    • Uninduced controls for inducible expression systems

    • Parent cells for gene-edited cell lines

  • Technical Controls:

    • Housekeeping proteins (β-actin) for Western blotting normalization

    • Internal standards for qRT-PCR (multiple reference genes)

    • Positive and negative antibody controls for immunostaining

    • Appropriate enzyme standards for biochemical assays

Including these comprehensive controls ensures experimental rigor and facilitates clear interpretation of results, particularly when evaluating subtle phenotypic differences between variant effects.

What are the emerging approaches for studying NDUFC2 dynamics in living systems?

Several cutting-edge methodologies are emerging as valuable tools for investigating NDUFC2 function in more physiologically relevant contexts:

  • Live-Cell Imaging:

    • Fluorescently tagged NDUFC2 constructs to visualize localization and dynamics

    • FRET-based approaches to study protein-protein interactions in real-time

    • Mitochondrial potential-sensitive dyes to correlate NDUFC2 function with membrane potential

    • Super-resolution microscopy to visualize NDUFC2 within the mitochondrial ultrastructure

  • Single-Cell Technologies:

    • Single-cell RNA-seq to analyze cell-specific responses to NDUFC2 dysfunction

    • Mass cytometry (CyTOF) to simultaneously measure multiple parameters in individual cells

    • Spatial transcriptomics to map NDUFC2 expression patterns in tissue contexts

  • Organoid Models:

    • Brain organoids derived from patient iPSCs to study neurological manifestations

    • Multi-tissue organoid systems to investigate tissue-specific effects of NDUFC2 variants

    • Microfluidic organ-on-chip approaches to study complex physiological interactions

These advanced approaches promise to provide deeper insights into NDUFC2 function within intact biological systems and may help explain the tissue-specific pathology observed in NDUFC2-related disorders.

How can contradictory data regarding NDUFC2's role in disease pathogenesis be reconciled?

Researchers encountering seemingly contradictory findings about NDUFC2's role in disease should consider several analytical approaches:

  • Variant-Specific Effects:

    • Different NDUFC2 variants may affect protein function differently

    • Compare structural locations of variants (functional domains vs. peripheral regions)

    • Evaluate quantitative differences in residual NDUFC2 activity between variants

    • Consider variant-specific effects on protein stability vs. functional interactions

  • Genetic and Environmental Modifiers:

    • The stroke phenotype in SHRSP rats is dependent on Japanese-style diet (JD)

    • Human stroke risk associated with NDUFC2 variants may be influenced by lifestyle factors

    • Genetic background differences may explain variable penetrance and expressivity

    • Epigenetic factors might modulate NDUFC2 expression in different contexts

  • Methodological Considerations:

    • Different experimental approaches may yield apparently contradictory results

    • In vitro studies may not fully recapitulate in vivo complexity

    • Acute vs. chronic models may reveal different aspects of NDUFC2 function

    • Species differences (human vs. rodent vs. cell culture) may influence findings

Systematic meta-analysis of available data with careful attention to methodological details and experimental contexts can help reconcile apparently contradictory findings and develop more nuanced understanding of NDUFC2's role in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.