Recombinant Pan troglodytes NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Genetic Origin and Expression

MT-ND3 is encoded by the mitochondrial genome, specifically by the MT-ND3 gene. In human mitochondrial DNA, the homologous gene is located from base pair 10,059 to 10,404 . The protein is a core component of NADH dehydrogenase (ubiquinone), also known as Complex I, which is situated in the mitochondrial inner membrane and represents the largest of the five complexes comprising the electron transport chain . Recombinant production of this protein typically involves expression in E. coli systems, where the full-length protein (amino acids 1-115) can be generated with various fusion tags to facilitate purification and downstream applications .

Role in Mitochondrial Respiration

MT-ND3 functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex plays a crucial role in cellular energy production by catalyzing the transfer of electrons from NADH to ubiquinone (coenzyme Q10), which represents the first step in the electron transport chain of oxidative phosphorylation . The protein is believed to be part of the minimal assembly required for catalysis within Complex I. Through its participation in this process, MT-ND3 contributes to the generation of the proton gradient across the inner mitochondrial membrane that drives ATP synthesis .

Interaction Network

Analysis of protein-protein interactions reveals that MT-ND3 operates within a highly integrated network of mitochondrial proteins. It shows strong functional associations with other components of the electron transport chain, including:

  1. NADH-ubiquinone oxidoreductase chains 1, 2, 4, and 5 (MT-ND1, MT-ND2, MT-ND4, MT-ND5)

  2. Cytochrome c oxidase subunits (COX1, COX2, COX3)

  3. ATP synthase subunit a (ATP6)

  4. Cytochrome b (CYTB)

  5. Cytochrome b-c1 complex subunits

These interactions underscore the integrated nature of the respiratory chain, where MT-ND3 functions as part of a larger macromolecular assembly responsible for mitochondrial energy production.

Expression Systems and Methodology

Recombinant Pan troglodytes MT-ND3 is typically produced in E. coli expression systems. The protein can be generated with various fusion tags, most commonly with an N-terminal histidine (His) tag to facilitate purification via immobilized metal affinity chromatography . The recombinant production process allows for the isolation of significant quantities of pure protein for various research applications.

Physical and Chemical Properties

The following table outlines the key characteristics of recombinant Pan troglodytes MT-ND3:

PropertyDescription
SpeciesPan troglodytes (Chimpanzee)
UniProt IDQ9T9V8
Protein LengthFull Length (1-115 amino acids)
Molecular WeightApproximately 13 kDa
Recommended Storage-20°C to -80°C
Storage BufferTris-based buffer with 50% glycerol, pH optimized
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
Stability NotesAvoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week
PurityGreater than 90% as determined by SDS-PAGE

This recombinant protein is typically supplied as a lyophilized powder and requires proper reconstitution before use in experimental procedures .

Mitochondrial Function Studies

Recombinant MT-ND3 serves as a valuable tool for investigating mitochondrial function, particularly in comparative studies between humans and non-human primates. The protein allows researchers to examine the specific contributions of Complex I subunits to electron transport chain efficiency and mitochondrial respiration .

Evolutionary Biology and Comparative Genomics

The availability of recombinant Pan troglodytes MT-ND3 facilitates comparative analyses between chimpanzee and human mitochondrial proteins. Such studies provide insights into the evolutionary conservation of respiratory chain components and the potential functional implications of sequence variations between species .

Biomedical Research and Disease Models

MT-ND3 variants in humans are associated with several mitochondrial disorders, including Leigh syndrome, MELAS (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes), and Leber's hereditary optic neuropathy . Recombinant chimpanzee MT-ND3 can serve as a comparative model for investigating the molecular basis of these disorders and potentially developing therapeutic approaches.

Quality Control Parameters

Commercial preparations of recombinant Pan troglodytes MT-ND3 typically undergo rigorous quality control to ensure purity and functionality. Standard criteria include purity assessment via SDS-PAGE (typically >90%), verification of protein size (approximately 13 kDa), and confirmation of amino acid sequence through mass spectrometry . These quality control measures are essential for ensuring the reliability and reproducibility of experimental results when using the recombinant protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MNFVLILMTNTLLALLLMIITFWLPQLNSYMEKSTPYECGFDPMSPARVPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTANLPLMVTSSLLLITILALSLAYEWLQKGLDWTE
Uniprot No.

Target Background

Function

Function: Recombinant Pan troglodytes NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor. MT-ND3 is essential for the catalytic activity of Complex I.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of MT-ND3 in Pan troglodytes?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) functions as a core subunit of mitochondrial respiratory chain Complex I. In Pan troglodytes, this protein is essential for the catalytic activity of Complex I, which transfers electrons from NADH through the respiratory chain using ubiquinone as an electron acceptor . The protein consists of approximately 115 amino acids and contains multiple transmembrane domains that assist in proton translocation across the mitochondrial membrane, generating an electrochemical gradient crucial for ATP synthesis .

Structurally, MT-ND3 in chimpanzees shares high sequence homology with human MT-ND3, reflecting their close evolutionary relationship. This conservation suggests critical functional constraints on this protein throughout primate evolution . The protein's hydrophobic nature facilitates its integration into the inner mitochondrial membrane where it performs its essential role in energy production.

How does Pan troglodytes MT-ND3 differ from human MT-ND3 at the sequence and functional levels?

Comparative analysis reveals that Pan troglodytes MT-ND3 exhibits high sequence conservation with human MT-ND3, with differences primarily in silent nucleotide substitutions rather than amino acid-changing variants . Studies analyzing mitochondrial DNA variation between humans and chimpanzees have found that the ratio of replacement to silent nucleotide substitutions is lower in interspecies comparisons than within either species . This pattern suggests purifying selection acting on MT-ND3 across evolutionary time.

What expression systems are most effective for producing recombinant Pan troglodytes MT-ND3 protein?

  • Codon optimization: The mitochondrial genetic code differs from standard nuclear code, necessitating codon optimization for bacterial expression.

  • Expression vectors: Vectors containing N-terminal His-tags facilitate purification while minimizing interference with protein folding .

  • Solubility enhancement: MT-ND3 is highly hydrophobic; fusion with solubility-enhancing tags (MBP, SUMO) may improve expression yields.

  • Membrane mimetics: Expression in the presence of membrane mimetics or using cell-free systems with lipid nanodiscs can improve proper folding.

When selecting between prokaryotic and eukaryotic systems, consider that while E. coli provides higher yields, insect cell systems may offer superior post-translational modifications and folding for this mitochondrial membrane protein. Mammalian expression systems might be necessary when studying interactions with other Complex I components.

What purification strategies overcome the hydrophobic nature of recombinant MT-ND3?

Purifying recombinant MT-ND3 requires specialized approaches due to its hydrophobicity and membrane-integrated nature:

Recommended Purification Protocol:

  • Solubilization: Use mild detergents (DDM, LMNG, or digitonin) to extract MT-ND3 from membranes while preserving native structure.

  • Affinity chromatography: Utilize His-tag affinity purification with imidazole gradient elution .

  • Size exclusion chromatography: Remove aggregates and impurities while maintaining protein in detergent micelles.

  • Detergent exchange: Consider nanodiscs or amphipols for downstream functional studies.

Optimization Parameters:

  • Buffer composition: Tris/PBS-based buffers with 6% trehalose at pH 8.0 have shown effective results .

  • Storage considerations: Store purified protein at -20°C/-80°C with 5-50% glycerol to prevent freeze-thaw damage .

  • Quality control: Verify purity via SDS-PAGE (>90% purity benchmark) and confirm identity through mass spectrometry .

How can researchers solve expression challenges when the MT-ND3 start codon differs from standard ATG?

MT-ND3 presents unique challenges as it's one of the mitochondrial genes that doesn't use ATG as its start codon (using ATA instead) . When designing recombinant expression constructs, researchers should:

  • Modify the start codon: Replace the native ATA with ATG to ensure efficient translation initiation in heterologous expression systems .

  • Codon optimization: Beyond the start codon, optimize the entire sequence for the expression system while preserving critical functional residues.

  • 5' optimization: Include an optimized Kozak sequence or other translation enhancement elements before the start codon.

  • Validation approach: Confirm proper translation using Western blot with MT-ND3 specific antibodies (such as those recognizing epitopes within amino acids 1-100) .

This start codon modification has been successfully employed in mitochondrial gene therapeutic strategies and should be considered essential when designing recombinant MT-ND3 expression constructs .

What are the most reliable methods for assessing MT-ND3 incorporation into Complex I and its functional activity?

Researchers can assess MT-ND3 incorporation and functionality using complementary approaches:

Structural Incorporation Analysis:

  • Blue Native PAGE: Separates intact Complex I to verify MT-ND3 incorporation

  • Immunoprecipitation: Using antibodies against other Complex I subunits to confirm MT-ND3 co-precipitation

  • Crosslinking mass spectrometry: Identifies specific interaction partners within the complex

Functional Assessment Methods:

  • Complex I activity assays: Measure NADH:ubiquinone oxidoreductase activity through spectrophotometric methods

  • Oxygen consumption measurements: Using Seahorse XF analyzers or Clark-type electrodes

  • Mitochondrial membrane potential: Using potential-sensitive dyes like TMRM or JC-1

Controls and Validation:

  • Utilize cells with known MT-ND3 mutations as negative controls

  • Compare activity with purified native Complex I from the same species

  • Assess activity in reconstituted systems with defined lipid compositions

These methodologies can distinguish between structural incorporation and functional integration, providing comprehensive characterization of recombinant MT-ND3 properties.

How can researchers effectively detect and quantify MT-ND3 mutations in heteroplasmic samples?

Detection and quantification of MT-ND3 mutations in heteroplasmic samples (containing both wild-type and mutant mtDNA) requires specialized methodologies:

Recommended Protocol Workflow:

  • Sample preparation: Isolate mitochondria and treat with RNase to remove surface-bound RNA

  • Total RNA extraction: Extract RNA from purified mitochondria

  • cDNA synthesis: Perform reverse transcription

  • Quantitative analysis: Implement ARMS-PCR (Amplification Refractory Mutation System-PCR) for precise quantification of mutation rates

Alternative Advanced Methods:

  • Next-generation sequencing: Provides comprehensive mutation profiles with detection thresholds as low as 1%

  • Droplet digital PCR: Offers absolute quantification without standard curves

  • Last-cycle hot PCR: Effective for quantifying heteroplasmic levels across different tissues

Validation Strategy:

  • Analyze multiple tissue types when available (muscle biopsy, blood, cultured cells)

  • Include controls with known heteroplasmy levels

  • Verify results using at least two independent methods

When analyzing MT-ND3 mutations, researchers should note that heteroplasmy levels can vary significantly between tissues and may be absent in cultured cell lines derived from patients, necessitating direct tissue analysis for accurate assessment .

How can MT-ND3 sequence data inform evolutionary analyses between human and non-human primates?

MT-ND3 represents a valuable genetic marker for evolutionary studies due to its essential function and unique patterns of sequence conservation:

Methodological Approach:

  • Sequence alignment: Compare complete MT-ND3 sequences across primate species

  • Substitution pattern analysis: Examine ratios of replacement to silent nucleotide substitutions

  • Selection pressure calculation: Calculate dN/dS ratios to identify evolutionary constraints

Key Findings from Comparative Studies:

  • Within-species MT-ND3 variation shows a higher ratio of replacement to silent substitutions compared to between-species comparisons

  • This pattern contradicts strictly neutral evolutionary models and suggests slightly deleterious effects of many mitochondrial protein polymorphisms

  • The observed pattern is consistent across most mitochondrial genes, indicating similar evolutionary constraints

Research Applications:

  • Reconstruction of primate phylogenetic relationships

  • Dating evolutionary divergence events

  • Identifying signatures of positive selection or functional adaptation

These analyses reveal that MT-ND3 evolution follows a pattern where slightly deleterious mutations may persist within species but are eliminated over evolutionary time, consistent with studies of human mitochondrial diseases .

What experimental approaches best demonstrate the functional consequences of MT-ND3 sequence divergence across species?

To investigate functional consequences of MT-ND3 sequence divergence across species, researchers should employ complementary approaches:

Recommended Experimental Design:

  • Recombinant protein studies:

    • Express MT-ND3 variants from different species in uniform cellular backgrounds

    • Assess protein stability, half-life, and incorporation efficiency into Complex I

  • Cybrid cell analysis:

    • Generate transmitochondrial cybrids with identical nuclear backgrounds but mitochondria from different species

    • Measure respiratory capacity, ROS production, and Complex I activity

  • Structural biology approaches:

    • Use cryo-EM to visualize species-specific differences in Complex I architecture

    • Identify interaction differences between MT-ND3 and other complex subunits

  • In silico predictions:

    • Employ molecular dynamics simulations to predict functional impacts of amino acid substitutions

    • Model proton pumping efficiency differences based on structural variations

Analysis Parameters:

  • Measure ATP production rates using substrates specific to Complex I

  • Assess resistance to environmental stressors and inhibitors

  • Quantify ROS production under standardized conditions

These methodologies provide mechanistic insights into how evolutionary changes in MT-ND3 may contribute to species-specific mitochondrial function and metabolic adaptation.

How can researchers accurately model MT-ND3 mutations associated with human mitochondrial diseases in experimental systems?

MT-ND3 mutations have been implicated in several human disorders, including Leigh syndrome and sensorimotor axonal polyneuropathy . To model these conditions:

Cell-Based Disease Modeling Approaches:

  • Patient-derived fibroblasts: Direct analysis of cells containing pathogenic mutations

  • Cybrid technology: Transfer patient mitochondria into standard nuclear backgrounds

  • CRISPR-based approaches: Introduction of specific mutations into mtDNA (challenging but emerging technology)

Functional Readouts for Disease Phenotypes:

  • Complex I activity measurements in isolated mitochondria

  • ATP production assays for different substrates used by Complex I

  • Microscopic analysis for morphological markers (e.g., ragged red fibers, paracrystalline inclusions)

  • Oxygen consumption and mitochondrial membrane potential measurements

Validation Requirements:

  • Compare results across multiple patient-derived samples

  • Analyze tissue-specific effects (e.g., muscle vs. neuronal cells)

  • Consider heteroplasmy levels, which often differ between tissues and affect phenotype severity

For comprehensive analysis, researchers should examine both biochemical parameters and histological features, as demonstrated in cases of MT-ND3 mutations causing sensorimotor polyneuropathy with reduced Complex I activity and characteristic mitochondrial ultrastructural abnormalities .

What therapeutic strategies targeting MT-ND3 show promise for mitochondrial disease treatment?

Several experimental approaches show potential for addressing MT-ND3-related mitochondrial disorders:

RNA Therapeutic Strategies:

  • Mitochondrial delivery of wild-type MT-ND3 mRNA using specialized delivery vehicles like MITO-Porters

  • RNA modification approaches including start codon optimization (ATA to ATG) to enhance translation efficiency

  • Post-transcriptional modifications like polyadenylation to improve mRNA stability

Alternative Therapeutic Approaches:

  • Metabolic bypassing of Complex I using alternative electron donors

  • Mitochondrially-targeted antioxidants to reduce ROS damage

  • Small molecule stabilizers of Complex I assembly

Delivery Methodologies:

  • Liposome-based systems with mitochondrial targeting sequences

  • Cell-penetrating peptides conjugated to therapeutic molecules

  • Viral vector approaches for sustained expression

Experimental Validation Methods:

  • Confirmation of mitochondrial localization using subcellular fractionation

  • Quantitative PCR to measure wild-type to mutant ratio changes after treatment

  • Functional assays to confirm restoration of Complex I activity and ATP production

These therapeutic strategies require tissue-specific optimization, as MT-ND3 mutations may affect different tissues with varying severity depending on their energy demands and heteroplasmy levels .

What are the key considerations when designing antibodies against Pan troglodytes MT-ND3 for research applications?

Developing effective antibodies against Pan troglodytes MT-ND3 requires addressing several technical challenges:

Antigen Design Strategies:

  • Epitope selection: The optimal immunogen corresponds to recombinant fragment proteins within amino acids 1-100 of MT-ND3, which has proven successful in human MT-ND3 antibody development

  • Species cross-reactivity: Due to high conservation, antibodies raised against human MT-ND3 often cross-react with chimpanzee protein

  • Hydrophobic regions: Avoid transmembrane domains as primary epitopes unless special adjuvants are used

Antibody Validation Requirements:

  • Confirmation of specificity via Western blot using recombinant protein and tissue lysates

  • Immunohistochemical validation in fixed tissue samples

  • Immunofluorescence analysis in relevant cell lines

Application-Specific Considerations:

ApplicationRecommended FormatValidation MethodSpecial Considerations
IHC-PPolyclonalParaffin-embedded tissue1:20-1:50 dilution range
ICC/IFPolyclonalFixation with PFA/Triton X-1004 μg/mL concentration optimal
Western BlotMonoclonalMitochondrial fractionRequires specialized extraction
IPEither formatComplex I pull-downMay require crosslinking

These parameters ensure development of research-grade antibodies suitable for multi-application analysis of MT-ND3 in comparative studies between human and chimpanzee samples.

How can researchers distinguish between pathogenic and neutral variants when analyzing novel MT-ND3 mutations?

Distinguishing pathogenic from neutral MT-ND3 variants requires a multi-faceted approach:

Computational Assessment Workflow:

  • Variant frequency analysis: Compare occurrence in population databases

  • Conservation scoring: Evaluate evolutionary conservation across species

  • Pathogenicity prediction: Use multiple bioinformatic programs (at least 6 complementary algorithms) to achieve consensus predictions

  • Structural modeling: Assess potential impact on protein structure and Complex I assembly

Experimental Validation Protocol:

  • Functional studies: Measure Complex I activity in patient samples or model systems

  • Heteroplasmy analysis: Quantify mutation load across different tissues

  • Segregation analysis: Assess correlation between mutation load and phenotype severity

  • Complementation studies: Test rescue with wild-type MT-ND3

Clinical Correlation Criteria:

  • Presence of characteristic clinical features (e.g., Leigh syndrome, polyneuropathy)

  • Mitochondrial morphological abnormalities (ragged red fibers, paracrystalline inclusions)

  • Biochemical evidence of Complex I dysfunction

  • Absence of other genetic causes explaining the phenotype

When evaluating novel variants, researchers should note that truncating mutations (frameshifts, nonsense) in MT-ND3 are typically pathogenic, while the pathogenicity of missense variants requires comprehensive evaluation using the above approach .

What methodological challenges exist when studying MT-ND3 depletion versus mutation effects, and how can they be overcome?

Distinguishing between MT-ND3 depletion (reduced copy number) and mutation effects presents significant methodological challenges:

Differential Analysis Protocol:

  • Quantitative assessment of mtDNA content:

    • Real-time PCR comparing mitochondrial to nuclear DNA ratios

    • Digital droplet PCR for absolute quantification

    • Next-generation sequencing with depth analysis

  • Mutation detection and quantification:

    • Deep sequencing to identify low-frequency variants

    • Last-cycle hot PCR for heteroplasmy quantification

    • ARMS-PCR for targeted mutation analysis

  • Protein expression analysis:

    • Western blotting with normalization to mitochondrial mass markers

    • Immunohistochemistry to assess tissue distribution patterns

    • Correlation with transcription factors like TFAM

Confounding Variables and Solutions:

ChallengeSolutionValidation Method
Tissue heterogeneitySingle-cell analysisCompare to bulk tissue
Nuclear MT-ND3 pseudogenesMitochondria isolation before analysis Purity verification
Compensatory mechanismsComprehensive OXPHOS assessmentMultiple timepoints
Cell culture artifactsCompare primary tissue to cultured cells Multiple passages analysis

By implementing these methodological approaches, researchers can accurately distinguish between primary MT-ND3 depletion and mutation effects, which is critical as these mechanisms may contribute differently to disease pathogenesis, as observed in studies of hepatocellular carcinoma and other mitochondrial disorders .

How can Pan troglodytes MT-ND3 research contribute to understanding human mitochondrial diseases?

Comparative studies of Pan troglodytes MT-ND3 offer unique insights into human mitochondrial pathology:

Research Value Proposition:

  • Evolutionary context: Chimpanzee MT-ND3 provides the closest evolutionary reference point for understanding human MT-ND3 function and pathogenic variation

  • Neutral variation catalog: Identifying variants tolerated in chimpanzees helps interpret human variants of uncertain significance

  • Functional adaptation: Reveals how subtle sequence differences contribute to metabolic adaptation

Methodological Framework:

  • Compare rates and patterns of MT-ND3 variation between humans and chimpanzees

  • Analyze the ratio of replacement to silent nucleotide substitutions within and between species

  • Evaluate whether patterns of variation conform to neutral evolutionary models or suggest selective constraints

Translational Applications:

  • Development of improved predictive algorithms for variant pathogenicity

  • Identification of conserved domains critical for function versus regions tolerant of variation

  • Understanding how background genetic context influences MT-ND3 variant effects

Research has demonstrated that the pattern of MT-ND3 variation contradicts strictly neutral models, with higher ratios of replacement to silent mutations within species than between species . This suggests many mitochondrial protein polymorphisms may be slightly deleterious, providing context for interpreting human mitochondrial disease mutations .

What emerging technologies will advance recombinant MT-ND3 research in the next five years?

Several cutting-edge technologies are poised to transform MT-ND3 research:

Emerging Methodological Advances:

  • Mitochondrial genome editing:

    • Base editing and prime editing technologies adapted for mitochondrial targets

    • CRISPR-free approaches for precise mtDNA modification

    • In vivo editing systems for disease model development

  • Advanced structural biology:

    • Cryo-EM techniques for visualizing MT-ND3 within native Complex I at near-atomic resolution

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

    • Integrative structural approaches combining multiple experimental datasets

  • Single-cell mitochondrial analytics:

    • Single-cell mtDNA sequencing for heteroplasmy analysis

    • Spatial transcriptomics integrated with mitochondrial functional readouts

    • Live-cell super-resolution imaging of MT-ND3 incorporation and dynamics

  • Therapeutic delivery innovations:

    • Next-generation MITO-Porter systems with enhanced targeting specificity

    • Extracellular vesicle-based delivery of MT-ND3 mRNA or protein

    • Allotopic expression systems with improved mitochondrial targeting

These technologies will enable unprecedented precision in studying MT-ND3 biology, from basic structural insights to therapeutic applications, accelerating both fundamental research and clinical translation for mitochondrial disorders.

What standardized protocols should researchers adopt when comparing results across different MT-ND3 studies?

To ensure reproducibility and meaningful comparison across MT-ND3 studies, researchers should adopt standardized protocols:

Recommended Standardization Framework:

  • Genetic characterization:

    • Complete mitochondrial genome sequencing rather than targeted gene analysis

    • Standardized heteroplasmy quantification methods (e.g., last-cycle hot PCR)

    • Haplogroup determination for proper genetic context

  • Functional assessment:

    • Defined substrate concentrations for Complex I activity measurements

    • Standardized conditions for ATP production assays

    • Normalized reporting of enzyme activities (e.g., relative to citrate synthase)

  • Cell and tissue handling:

    • Consistent protocols for mitochondrial isolation

    • Standardized RNase treatment to remove surface-bound RNA

    • Defined passages for cultured cells with documented mitochondrial integrity

  • Data reporting requirements:

    • Complete sequence data deposition in standard databases

    • Documentation of all predicted protein changes using standardized nomenclature

    • Reporting of both absolute and normalized values for functional assays

Interlaboratory Validation Approach:

  • Establish reference materials with defined MT-ND3 variants and heteroplasmy levels

  • Implement round-robin testing of standardized samples

  • Develop consensus quality control metrics for key assays

Adoption of these standardized protocols will facilitate data integration across studies, enabling meta-analyses and accelerating progress in understanding MT-ND3 biology in both normal physiology and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.