Recombinant Pan troglodytes Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRNA5; Neuronal acetylcholine receptor subunit alpha-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-468
Protein Length
Full Length of Mature Protein
Species
Pan troglodytes (Chimpanzee)
Target Names
CHRNA5
Target Protein Sequence
RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQ LVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGR FEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIIL EDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCI GLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMI FVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHTLPKLLCMRSHVDRYFTQKEETES GSGPKSSRNTLEAALDSVRCITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVG SLGLFVPVIYKWANILIPVHIGNANK
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change affecting all subunits. This change leads to the opening of an ion-conducting channel across the plasma membrane.
Database Links
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-5/CHRNA5 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CHRNA5 in nicotinic acetylcholine receptors?

CHRNA5 serves as an essential modulatory subunit in nicotinic acetylcholine receptors (nAChRs). Unlike other alpha-type subunits, CHRNA5 cannot form functional channels independently or solely with beta-type subunits . Instead, CHRNA5 participates in nAChRs only when co-expressed with both another alpha-type and a beta-type subunit . This unique characteristic means CHRNA5 contributes to the lining of functionally distinctive nAChR channels with specific ion conductance properties .

After acetylcholine binding, the receptor undergoes an extensive conformational change affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane . This allows ion flow, primarily cations, which modulates neural signaling . Notably, nAChRs containing the alpha5 subunit show heightened sensitivity, being potently activated and desensitized by nanomolar concentrations of nicotine .

How can researchers verify successful incorporation of CHRNA5 into functional receptors?

Verification of CHRNA5 incorporation into functional receptors requires specialized electrophysiological and biochemical approaches:

  • Reporter Mutation Approach: This established technique involves introducing specific mutations in the CHRNA5 subunit that alter channel conductance or ion selectivity . Successful incorporation is confirmed when these altered properties are detected in electrophysiological recordings.

  • Electrophysiological Characterization: Two-electrode voltage clamp recordings comparing wild-type receptors with those containing CHRNA5 can reveal distinctive functional profiles, including:

    • Concentration-response curves using a four-parameter logistic equation

    • EC50 determinations (concentration producing half-maximal response)

    • Maximal response values

  • Statistical Validation: Compare parameters between receptors with and without CHRNA5 using:

    • Two-way ANOVA for concentration-response relationships

    • Student's t-test (two-tailed) for comparing maximal response and EC50 values

What expression systems are suitable for recombinant CHRNA5 production?

Based on established protocols for human CHRNA5 and similar proteins, several expression systems can be utilized:

Table 1: Expression Systems for Recombinant CHRNA5 Production

Expression SystemAdvantagesLimitationsApplications
Wheat Germ- Eukaryotic post-translational modifications
- High yield of soluble protein
- Suitable for functional studies
- Limited glycosylation patterns
- Higher cost than bacterial systems
- SDS-PAGE
- ELISA
- Western Blot
Mammalian Cell Lines- Native-like post-translational modifications
- Proper protein folding
- Suitable for functional studies
- Lower yields
- Longer production times
- More complex protocols
- Electrophysiology
- Binding assays
- Co-immunoprecipitation
Xenopus Oocytes- Robust expression of functional channels
- Well-established for electrophysiology
- Co-expression of multiple subunits
- Not suitable for protein purification
- Individual variation between oocytes
- Electrophysiological recordings
- Pharmacological characterization
E. coli- High yield
- Cost-effective
- Rapid production
- Lack of post-translational modifications
- Often forms inclusion bodies
- May require refolding
- Antigen production
- Limited structural studies

For most functional studies, co-expression systems that allow incorporation of CHRNA5 with other nAChR subunits are essential, given that CHRNA5 cannot form functional channels independently .

How do genetic variants in CHRNA5 affect receptor function and their relationship to nicotine dependence?

Genetic variation in CHRNA5 significantly impacts receptor function and has been strongly associated with nicotine dependence in humans. Research methodologies to investigate these relationships include:

  • SNP Genotyping Approaches:

    • Restriction Fragment Length Polymorphism (RFLP) assays: For example, rs16969968 can be genotyped using PCR with specific primers followed by Taq1 restriction enzyme digestion

    • Detection via gel electrophoresis on 2% agarose gels

    • Next-generation sequencing for comprehensive variant identification

  • Functional Characterization of Variants:

    • Patch-clamp electrophysiology comparing wild-type and variant receptors

    • Concentration-response curves for nicotine and acetylcholine

    • Assessment of receptor desensitization kinetics

    • Calcium imaging to evaluate signaling differences

  • Statistical Analysis for Association Studies:

    • Two-way ANOVA to evaluate differences in concentration-response relationships

    • Logistic regression models to assess variant associations with phenotypes

    • Multiple testing corrections to control for false discovery rates

Studies confirm that at least two independent variants in the nicotinic receptor gene cluster contribute to habitual smoking development . Of particular interest is rs16969968, which results in an amino acid substitution (D398N) that alters receptor function. This variant can be studied by comparing α4β2α5D398 and α4β2α5N398 receptor populations to determine differences in EC50 values, maximal responses, and desensitization rates .

What are the technical challenges and solutions for studying CHRNA5 incorporation in heteromeric receptors?

Studying CHRNA5 incorporation presents several technical challenges due to its unique assembly requirements and stoichiometry. The following methodological approaches address these challenges:

Table 2: Technical Challenges and Solutions for CHRNA5 Incorporation Studies

ChallengeTechnical SolutionMethodological Approach
Verifying subunit incorporationReporter mutationsIntroduce mutations that alter channel properties and detect functional changes using electrophysiology
Determining receptor stoichiometryFRET/BRET analysisLabel different subunits with fluorescent proteins to measure energy transfer between them
Distinguishing CHRNA5-containing receptorsPharmacological profilingUse subtype-selective compounds to isolate CHRNA5-containing receptor populations
Low expression levelsOptimized expression constructsCodon optimization, enhanced promoters, and chaperone co-expression
Functional characterizationAutomated patch-clamp systemsHigh-throughput assessment of receptor properties across multiple experimental conditions
Protein-protein interactionsCo-immunoprecipitationUse antibodies against CHRNA5 (like ab166718) for pull-down assays followed by Western blotting

When designing experiments to study CHRNA5 incorporation, researchers should always include controls with alternative subunit combinations to distinguish specific CHRNA5 contributions from general nAChR properties. Particularly, comparing α4β2 receptors with α4β2α5 receptors can isolate the functional impact of CHRNA5 incorporation .

How can researchers design synthetic genetic circuits to study CHRNA5 function in specialized environments like microgravity?

Designing synthetic genetic circuits to study CHRNA5 function in specialized environments requires sophisticated bioengineering approaches. Based on existing synthetic biology frameworks for studying proteins under microgravity conditions, the following methodological pipeline can be applied:

  • Design Principles for Microgravity-Responsive Genetic Circuits:

    • Identify microgravity-responsive regulatory elements (e.g., HfQ protein deregulation in E. coli under microgravity)

    • Engineer synthetic small regulatory RNAs (synsRNA) targeting CHRNA5 expression

    • Implement fluorescent reporter systems (EGFP, TdTomato) for real-time monitoring

  • Fabrication and Validation Process:

    • Construct expression vectors containing:

      • Constitutive or inducible promoters

      • CHRNA5 coding sequence

      • Reporter gene cassettes

      • Microgravity-responsive regulatory elements

    • Transform into appropriate cellular systems (E. coli for circuit testing, mammalian cells for functional studies)

    • Validate circuit function under normal gravity conditions

  • Testing Under Simulated Microgravity:

    • Utilize rotating wall vessel bioreactors or random positioning machines

    • Implement real-time fluorescence monitoring systems

    • Compare control and experimental conditions using DIC and fluorescence imaging

  • Data Analysis Methods:

    • Quantitative image analysis of fluorescence intensity

    • GSEA (Gene Set Enrichment Analysis) to identify altered molecular pathways

    • Statistical comparison of expression levels between normal and microgravity conditions using t-tests or ANOVA

This approach has been successfully implemented for studying other proteins under microgravity, showing approximately 28-fold differences in expression between normal and microgravity conditions . For CHRNA5 studies, additional consideration should be given to the multi-subunit nature of functional nAChRs.

What methodologies are effective for studying CHRNA5 in comparative genomics between humans and Pan troglodytes?

Comparative genomic analysis of CHRNA5 between humans and chimpanzees requires a multi-faceted approach integrating bioinformatics, molecular biology, and functional characterization:

  • Sequence Analysis Methodology:

    • Multiple sequence alignment using MUSCLE or Clustal tools

    • Phylogenetic analysis to determine evolutionary relationships

    • Identification of conserved domains and species-specific variations

    • dN/dS ratio calculation to identify selection pressures on specific regions

  • Structural Comparison Approach:

    • Homology modeling of chimpanzee CHRNA5 based on human crystal structures

    • Molecular dynamics simulations to predict functional implications of sequence differences

    • Binding site analysis for ligands and interacting proteins

  • Functional Validation Methods:

    • Creation of chimeric receptors swapping domains between human and chimpanzee CHRNA5

    • Electrophysiological characterization of species-specific properties

    • Pharmacological profiling to identify species differences in drug responses

    • Protein expression and localization studies in heterologous systems

  • Transcriptional Regulation Analysis:

    • Comparative promoter analysis between species

    • ChIP-seq to identify species-specific transcription factor binding

    • Reporter assays to quantify expression differences

Given the high sequence homology expected between human and chimpanzee CHRNA5 (typically >98% for most proteins), particular attention should be paid to non-synonymous substitutions that might alter protein function and regulatory regions that could influence expression patterns.

What are the optimal conditions for characterizing recombinant CHRNA5 using electrophysiology?

Electrophysiological characterization of recombinant CHRNA5-containing receptors requires careful experimental design to obtain reliable and reproducible results:

  • Expression System Selection and Preparation:

    • Xenopus oocytes: Most widely used system due to robust expression

      • Inject mRNA for all required subunits in optimized ratios (typically 1:1:10 for α5:α4:β2)

      • Allow 2-4 days for expression before recording

    • Mammalian cell lines: HEK293, SH-SY5Y, or PC12 cells

      • Transfect using lipofection or electroporation

      • Use expression vectors with fluorescent markers to identify transfected cells

  • Recording Configuration and Parameters:

    • Two-electrode voltage clamp (for oocytes):

      • Holding potential: -60 mV

      • Sample rate: ≥200 Hz

      • Filter: Low-pass at 50 Hz

    • Patch clamp (for mammalian cells):

      • Whole-cell configuration

      • Series resistance compensation: >70%

      • Holding potential: -70 mV

  • Solution Compositions:

    Table 3: Standard Solutions for nAChR Electrophysiology

    SolutionCompositionPurpose
    ND96 (oocyte)96 mM NaCl, 2 mM KCl, 1 mM MgCl₂, 1.8 mM CaCl₂, 5 mM HEPES, pH 7.4Recording bath solution
    Extracellular (mammalian)140 mM NaCl, 5.4 mM KCl, 1 mM MgCl₂, 1.8 mM CaCl₂, 5 mM HEPES, 10 mM glucose, pH 7.4Recording bath solution
    Intracellular (patch)140 mM CsCl, 10 mM EGTA, 10 mM HEPES, 4 mM Mg-ATP, pH 7.2Pipette solution
  • Pharmacological Characterization:

    • Generate full concentration-response curves for acetylcholine and nicotine

    • Include specific antagonists to isolate CHRNA5-containing receptors

    • Apply test compounds using a fast perfusion system

    • Allow sufficient time between applications (1-2 minutes) to minimize desensitization

  • Data Analysis Approach:

    • Normalize responses to maximum acetylcholine response

    • Fit concentration-response data with a four-parameter logistic equation

    • Calculate EC50 and Hill coefficient values

    • Analyze using two-way ANOVA for comparison between receptor subtypes

When comparing receptors with and without CHRNA5, particular attention should be paid to desensitization kinetics, as CHRNA5-containing receptors show distinctive desensitization profiles at nanomolar nicotine concentrations .

How should researchers troubleshoot protein expression and purification issues with recombinant CHRNA5?

Recombinant CHRNA5 expression and purification can present several challenges. The following troubleshooting guide addresses common issues and provides methodological solutions:

Table 4: Troubleshooting Guide for CHRNA5 Expression and Purification

IssuePotential CausesMethodological Solutions
Low expression yield- Suboptimal codon usage
- Protein toxicity
- mRNA instability
- Optimize codons for expression system
- Use inducible promoters
- Co-express with chaperones
- Lower induction temperature (16-20°C)
Protein insolubility- Improper folding
- Hydrophobic transmembrane domains
- Absence of interacting subunits
- Express as fragment (e.g., 38-131 aa range)
- Add solubility tags (MBP, SUMO)
- Include detergents (DDM, CHAPS)
- Try wheat germ cell-free system
Poor purity- Non-specific binding to resins
- Degradation
- Aggregation
- Optimize imidazole concentration in washes
- Add protease inhibitors
- Include reducing agents
- Perform size exclusion chromatography
Loss of immunoreactivity- Epitope masking
- Denaturation
- Proteolytic cleavage
- Try multiple antibodies targeting different regions
- Use native conditions where possible
- Validate with Western blot under various conditions
Failed functional assays- Incomplete receptor assembly
- Improper post-translational modifications
- Inactive conformation
- Co-express with other nAChR subunits
- Use mammalian or insect cell systems
- Include positive controls (known functional proteins)

For optimal results with recombinant CHRNA5, consider expressing it as a fragment protein (38-131 aa range) in a wheat germ expression system, which has been successfully demonstrated for human CHRNA5 . This approach yields protein suitable for SDS-PAGE, ELISA, and Western blot applications . For functional studies, co-expression with other nAChR subunits (particularly another alpha subunit and a beta subunit) is essential since CHRNA5 alone cannot form functional channels .

What methodological approaches are effective for studying CHRNA5 knockout models?

Studying CHRNA5 knockout models requires systematic approaches spanning from generation to phenotypic characterization. The following methodological framework provides guidance for effective CHRNA5 knockout studies:

  • Knockout Generation Strategies:

    • CRISPR/Cas9 approach:

      • Design sgRNAs targeting exonic regions critical for protein function

      • Screen for frameshift mutations that disrupt protein expression

      • Validate knockout at DNA (sequencing), RNA (qPCR), and protein (Western blot) levels

    • Conditional knockout systems:

      • Implement Cre-loxP systems for tissue-specific deletion

      • Use inducible promoters for temporal control of knockout

  • Phenotypic Characterization:

    • Nicotine consumption assays:

      • Two-bottle choice tests with varying nicotine concentrations

      • Self-administration paradigms with detailed behavioral analysis

      • Monitor consumption patterns and dose-dependent responses

    • Electrophysiological assessment:

      • Compare receptor populations in wild-type vs. knockout tissues

      • Analyze changes in synaptic transmission in relevant brain regions

      • Measure alterations in cellular excitability

  • Modifier Gene Identification:

    • Genetic background manipulation:

      • Cross knockout lines with different strain backgrounds

      • Implement QTL mapping to identify modifier loci

      • Perform RNA-seq analysis to identify compensatory mechanisms

    • Pharmacological modifiers:

      • Screen compounds that affect nicotine consumption in knockout models

      • Compare response profiles with wild-type animals

      • Identify potential therapeutic targets

  • Data Analysis Framework:

    • Statistical approaches:

      • ANOVA with post-hoc tests for multi-group comparisons

      • Regression analysis for dose-dependency relationships

      • Mixed-effects models for repeated measures designs

    • Systems biology integration:

      • Pathway analysis of differentially expressed genes

      • Network modeling of affected signaling cascades

      • Integration of behavioral, electrophysiological, and molecular data

Genetic background significantly influences phenotypes in CHRNA5 knockout models, particularly regarding nicotine consumption behaviors . Therefore, careful consideration of genetic background and potential modifier genes is essential when designing and interpreting knockout studies.

What novel methodologies are emerging for studying CHRNA5 structure-function relationships?

Emerging technologies are revolutionizing our ability to study CHRNA5 structure-function relationships with unprecedented precision:

  • Cryo-EM for High-Resolution Structural Analysis:

    • Implementation of single-particle cryo-EM to resolve full nAChR structures at near-atomic resolution

    • Visualization of CHRNA5 within the assembled pentameric receptor context

    • Structural comparison of receptors with different subunit compositions

    • Methodological approach:

      • Expression of full-length receptors in mammalian expression systems

      • Purification in native-like lipid nanodiscs or detergent micelles

      • Vitrification and imaging with direct electron detectors

      • Single-particle reconstruction and model building

  • Advanced Mutagenesis Strategies:

    • Deep mutational scanning:

      • Generate comprehensive libraries of CHRNA5 point mutants

      • Functional screening using fluorescence-based assays

      • Next-generation sequencing to correlate sequence with function

    • Unnatural amino acid incorporation:

      • Site-specific introduction of photo-crosslinkable residues

      • Precise mapping of protein-protein interactions within the receptor complex

      • Identification of conformational changes during channel gating

  • Single-Molecule Techniques:

    • Single-molecule FRET:

      • Strategic placement of fluorophore pairs on CHRNA5 and interacting subunits

      • Real-time tracking of conformational dynamics during channel activation

      • Correlation of structural movements with electrophysiological recordings

    • Optical tweezers combined with electrophysiology:

      • Direct measurement of forces associated with channel gating

      • Correlation of mechanical properties with ion channel function

  • Computational Methods:

    • Enhanced sampling molecular dynamics:

      • Simulation of complete receptor dynamics on microsecond timescales

      • Identification of CHRNA5-specific contributions to channel function

      • Prediction of effects from sequence variations between species

    • Machine learning approaches:

      • Development of models to predict functional outcomes from sequence data

      • Integration of structural, functional, and genetic information

      • Identification of critical residues for selective targeting

These emerging methodologies promise to provide unprecedented insights into how CHRNA5 contributes to receptor assembly, ion channel properties, and ultimately, how genetic variations affect receptor function and associated phenotypes like nicotine dependence.

How can integrative multi-omics approaches advance our understanding of CHRNA5 function across species?

Integrative multi-omics approaches offer powerful frameworks for comprehensive understanding of CHRNA5 function across species:

  • Multi-layered Data Collection Methodology:

    • Genomics:

      • Whole genome sequencing to identify regulatory regions and structural variations

      • Comparative genomics across primates to identify conserved and divergent regions

      • Epigenomic profiling (ChIP-seq, ATAC-seq) to map regulatory landscapes

    • Transcriptomics:

      • RNA-seq to quantify expression levels across tissues and developmental stages

      • Single-cell transcriptomics to identify cell-type specific expression patterns

      • Alternative splicing analysis to characterize isoform diversity

    • Proteomics:

      • Global proteome analysis to quantify protein abundance

      • Post-translational modification mapping

      • Interactome characterization through AP-MS or BioID approaches

    • Functional genomics:

      • CRISPR screens to identify genetic modifiers of CHRNA5 function

      • Pharmacological profiling across species

  • Integrative Analysis Framework:

    • Systems biology pipeline development:

      • Implement GSEA (Gene Set Enrichment Analysis) to identify altered molecular pathways

      • Develop mathematical models of receptor function across species

      • Create interactome maps specific to different species

    • Machine learning integration:

      • Train models on multi-omics data to predict cross-species functional differences

      • Implement dimensionality reduction techniques to identify key functional determinants

      • Develop classification algorithms for phenotypic outcomes

  • Experimental Validation Strategy:

    • Humanized animal models:

      • Create chimeric models expressing human CHRNA5 variants in model organisms

      • Detailed phenotypic characterization across multiple behavioral domains

      • Pharmacological validation of predicted functional differences

    • Patient-derived models:

      • iPSC generation from humans and non-human primates

      • Differentiation into relevant neural subtypes

      • Functional characterization using electrophysiology and calcium imaging

This integrative approach has been successfully applied to other complex biological systems, revealing insights that were not apparent from single-omics analyses . For CHRNA5, such approaches could reveal species-specific regulatory mechanisms, interaction networks, and functional adaptations that underlie differences in nicotinic receptor biology between humans and chimpanzees.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.