Recombinant Pan troglodytes Olfactory receptor 1A1 (OR1A1)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant OR1A1 is typically produced using:

  • Expression Systems: Stable tetracycline-inducible HEK293S cells or E. coli .

  • Purification Workflow:

    • Step 1: Anti-FLAG immunoaffinity chromatography.

    • Step 2: Gel filtration chromatography, yielding monomeric (~1.6 mg) and dimeric (~1.1 mg) forms .

  • Quality Control: Circular dichroism confirms proper folding; intrinsic tryptophan fluorescence assays validate ligand binding .

Ligand Binding and Activation

  • Primary Ligand: Dihydrojasmone (affinity: micromolar range) .

  • Enantiomer Selectivity: OR1A1 discriminates between (R)-(−)-carvone (minty) and (S)-(+)-carvone (caraway), with a hominid-specific binding pocket involving 11 critical amino acids .

Applications in Research

Recombinant OR1A1 is utilized for:

  • Odorant Receptor Deorphanization: Identifying ligands for understudied olfactory receptors .

  • Structural Biology: Facilitating crystallographic and NMR studies to resolve GPCR activation mechanisms .

  • Anosmia Studies: Investigating genetic variants (e.g., SNPs) linked to odor-specific insensitivity .

Current Research Frontiers

  • Carvone Anosmia: ~8% of humans exhibit insensitivity to (R)-(−)-carvone, with OR1A1 proposed as a candidate receptor .

  • Genetic Variation: Functional haplotypes (e.g., OR11A1-MA/MT/TA) show altered ligand sensitivity, highlighting OR1A1’s role in personalized olfaction studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
OR1A1; Olfactory receptor 1A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVHLHNPMY FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC GSHLTVVSLYYGTVMGMYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDVKAALR KLFNKRISS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pan troglodytes OR1A1 and how does it compare structurally to human OR1A1?

The Pan troglodytes olfactory receptor 1A1 (PTOR1A1) is a G-protein-coupled receptor expressed in the olfactory epithelium of chimpanzees. Like its human ortholog (OR1A1), it belongs to the large family of olfactory receptors that mediate odor recognition through a 7-transmembrane domain structure.

Comparative analysis shows extremely high sequence conservation between human OR1A1 and chimpanzee PTOR1A1, reflecting their close evolutionary relationship. This conservation is particularly evident in the carvone binding pocket of OR1A1, which exhibits approximately 100% conservation among hominids based on ortholog comparison studies across 36 mammalian species .

The transmembrane helices (TMH) forming the binding pocket are especially conserved, with key amino acid residues involved in ligand binding being identical between these species. This high level of conservation suggests similar odorant recognition properties between human and chimpanzee OR1A1 proteins .

What expression systems are most effective for recombinant OR1A1 production?

For recombinant production of Pan troglodytes OR1A1, several expression systems have been utilized with varying degrees of success:

E. coli Expression System:
E. coli has been successfully employed for recombinant OR1A1 production, particularly when the protein is expressed with an N-terminal tag to improve folding and solubility . The protocol typically involves:

  • Cloning the OR1A1 gene into expression vectors such as pI2-dk

  • Addition of an N-terminal tag (such as the first 39 amino acids of bovine rhodopsin) to enhance membrane insertion

  • Transformation into competent E. coli strains (e.g., XL1-blue)

  • Purification using appropriate methods for membrane proteins

Mammalian Cell Expression:
For functional studies requiring proper post-translational modifications, mammalian cell systems are often preferred. These systems better recapitulate the native cellular environment for GPCR folding and processing.

Expression SystemAdvantagesChallengesSuitable Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential improper foldingStructural studies, antibody generation
Mammalian cells (HEK293, etc.)Native-like folding, proper post-translational modificationsLower yield, higher costFunctional assays, ligand binding studies
Insect cellsModerate yield, some post-translational modificationsMore complex than E. coli, less than mammalian cellsBalance between yield and function

How is functional activity of recombinant Pan troglodytes OR1A1 assessed in vitro?

Functional assessment of recombinant PTOR1A1 typically employs several complementary approaches:

cAMP-Sensitive Luciferase Assays:
The most widely used method involves a cAMP-sensitive luciferase assay, where OR activation is measured through downstream cAMP production. This approach has been successfully employed for testing OR responses to specific ligands including carvone enantiomers . The methodology involves:

  • Transfection of cells with the recombinant receptor

  • Addition of potential ligands at various concentrations

  • Measurement of cAMP production using a luciferase reporter system

  • Calculation of EC50 values to determine ligand potency

Calcium Imaging:
Another common approach measures intracellular calcium flux upon receptor activation, which is particularly useful for real-time response monitoring.

Binding Assays:
Direct binding assays using labeled ligands can provide information about binding affinity and kinetics.

What ligands are known to bind to OR1A1 proteins?

OR1A1 is considered a broadly tuned receptor, responding to various odorant molecules. Key ligands identified for human OR1A1, which are likely similar for Pan troglodytes OR1A1 due to high sequence conservation, include:

  • Carvone enantiomers: Both (R)-(−)-carvone and (S)-(+)-carvone activate OR1A1, with a higher selectivity for (R)-(−)-carvone

  • (S)-(−)-citronellal

  • Helional

  • Aldehydes: Heptanal, octanal, nonanal

  • Hydroxycitronellal

  • Citral

  • Citronellol (both enantiomers)

  • Dihydrojasmone

  • Thiols

  • (+)-dihydrocarvone

The binding pocket formed by transmembrane helices 3, 5, 6, and 7 accommodates these ligands, with key interactions typically occurring within approximately 4 Å between the ligand and amino acid residues in the receptor .

What molecular determinants contribute to enantiomer selectivity in OR1A1?

The enantiomer selectivity of OR1A1 for carvone stereoisomers represents an important model for understanding the molecular basis of olfactory discrimination. Research indicates several key molecular determinants:

Key Binding Site Residues:
Site-directed mutagenesis studies have identified specific amino acid residues that contribute to the selective binding of (R)-(−)-carvone over (S)-(+)-carvone in human OR1A1. These residues are likely conserved in Pan troglodytes OR1A1 due to the high sequence identity between these orthologs .

Transmembrane Helices Configuration:
The arrangement of transmembrane helices, particularly TMH3, TMH5, TMH6, and TMH7, creates a binding pocket that accommodates the carvone molecule. The specific proline patterns in TMH6 (Pro6.54) and TMH7 (Pro7.46) create distinctive kinks that shape the binding pocket, influencing enantiomer selectivity .

Binding Pocket Size and Electrostatic Properties:
The modified proline kink in TMH6 and additional kink in TMH7 result in a smaller binding pocket, particularly between TMH1-3 and TMH7. This confined space likely contributes to the specific orientation requirements for effective ligand binding and discrimination between enantiomers .

In homology modeling studies, tyrosine residues, particularly Tyr251, have been identified as forming critical close contacts (under 4 Å) with ligands such as (+)-dihydrocarvone, suggesting similar interactions may occur with carvone enantiomers .

How should site-directed mutagenesis be designed for studying OR1A1 binding pocket residues?

Site-directed mutagenesis represents a powerful approach for investigating the functional role of specific amino acids in OR1A1. Based on published methodologies, the following protocol is recommended:

PCR-Based Two-Step Mutagenesis Protocol:

  • Design overlapping mutation primers containing the desired nucleotide changes

  • Perform two separate PCR reactions:

    • First reaction: Forward vector-internal primer + reverse mutation primer

    • Second reaction: Forward mutation primer + reverse vector-internal primer

  • Purify both PCR products and use them as templates for a second PCR with vector-internal primers

  • Digest the final PCR product with appropriate restriction enzymes (e.g., EcoRI/NotI or MfeI/NotI)

  • Ligate into an expression vector (e.g., pI2-dk with a rhodopsin tag)

  • Transform into competent E. coli

  • Verify mutations by Sanger sequencing

Target Residues Selection Strategy:
When selecting residues for mutagenesis, prioritize:

  • Amino acids identified in homology modeling and docking studies

  • Residues showing high conservation across orthologs but differing between paralogs

  • Residues within 4-5 Å of predicted ligand binding sites

  • Positions corresponding to known functional residues in related ORs

What computational modeling approaches best predict ligand interactions with Pan troglodytes OR1A1?

Computational modeling of OR1A1-ligand interactions involves several sophisticated approaches:

Homology Modeling Strategy:
For producing accurate OR1A1 structural models:

  • Select appropriate templates: Use multiple GPCR structures as templates, particularly those in activated conformations (e.g., human β2-adrenergic receptor, human adenosine receptor, bovine rhodopsin)

  • Perform multiple sequence alignment of template structures

  • Generate models using software like MODELLER that can incorporate information from multiple templates

  • Validate the model using Ramachandran plots and transmembrane prediction tools like Phobius

Molecular Docking Workflow:
For predicting ligand binding modes:

  • Prepare ligand structures through geometric optimization using density functional theory (B3LYP) with split-valence basis set 6-31G(d,p)

  • Calculate molecular vibrational frequencies for ligands using GAMESS or similar software

  • Perform molecular docking simulations identifying key residues within 4 Å of the ligand

  • Analyze binding energy profiles and interaction patterns

Molecular Descriptor Approach:
A particularly useful technique is the corralled intensity of molecular vibrational frequency (CIMVF) as a molecular descriptor for ligands. This approach allows for systematic analysis of structure-activity relationships by:

  • Calculating vibrational frequencies of optimized ligand structures

  • Sorting wavenumbers in increasing order into fixed step size corrals (e.g., 5 cm-1)

  • Creating a one-dimensional vector representing the wavenumber range (0-4,000 cm-1)

How do single nucleotide polymorphisms (SNPs) affect OR1A1 function across primate species?

Single nucleotide polymorphisms in OR1A1 can significantly impact receptor function and may contribute to species-specific olfactory capabilities:

Loss-of-Function SNPs:
Research has identified several loss-of-function SNPs associated with the carvone binding pocket of human OR1A1 . Similar analyses in Pan troglodytes OR1A1 would likely reveal primate-specific polymorphisms that may explain differences in olfactory perception between humans and chimpanzees.

What are the optimal experimental conditions for measuring Pan troglodytes OR1A1 activity in heterologous expression systems?

To achieve reliable functional measurements of PTOR1A1 activity in heterologous systems, the following experimental conditions are recommended:

Transfection and Expression Parameters:

  • Vector selection: Use vectors with strong constitutive promoters for mammalian expression

  • N-terminal modification: Include the first 39 amino acids of bovine rhodopsin as a tag to improve surface expression

  • Cell line selection: HEK293 cells are commonly used for functional olfactory receptor studies

  • Expression verification: Confirm surface expression through immunocytochemistry or flow cytometry using the N-terminal tag

Functional Assay Optimization:

  • Assay selection: cAMP-sensitive luciferase assays provide sensitive detection of receptor activation

  • Positive controls: Include known activators such as (R)-(−)-carvone at multiple concentrations

  • Temperature: Perform assays at physiological temperature (37°C)

  • Ligand preparation: Prepare fresh ligand dilutions in appropriate vehicles (typically DMSO, not exceeding 0.1% final concentration)

  • Signal normalization: Normalize signals to cell number or total protein content

Data Analysis Considerations:

  • Dose-response curves: Analyze using nonlinear regression to determine EC50 values

  • Sufficient replication: Perform experiments with at least 3-4 biological replicates

  • Statistical analysis: Apply appropriate statistical tests (typically ANOVA with post-hoc tests)

  • Receptor specificity controls: Include closely related receptors (e.g., OR1A2) as specificity controls

How does OR1A1 sequence conservation inform our understanding of olfactory evolution in primates?

The evolutionary analysis of OR1A1 provides valuable insights into primate olfactory system development:

Hominid-Specific Conservation Patterns:
The carvone binding pocket in OR1A1 shows approximately 100% conservation among hominid species, suggesting strong selective pressure to maintain specific odorant recognition capabilities throughout recent primate evolution . This high conservation contrasts with the general pattern of high variability in the olfactory receptor gene family, indicating functional significance for OR1A1.

Ortholog Comparison Across Mammals:
Comparative analyses across 36 mammalian species have demonstrated that the highly conserved carvone binding pocket is hominid-specific . This suggests that the ability to detect and discriminate between carvone enantiomers might have had particular evolutionary significance in hominid evolution.

The phylogenetic relationship between human OR1A1, chimpanzee PTOR1A1, and other mammalian orthologs such as bovine btOR1A1 and murine Olfr43 provides a framework for understanding how specific olfactory capabilities have evolved across mammalian lineages .

What experimental approaches can elucidate functional differences between human and Pan troglodytes OR1A1?

To investigate functional differences between human and chimpanzee OR1A1 orthologs, several complementary approaches can be employed:

Reciprocal Mutagenesis:
By introducing species-specific amino acid changes from one ortholog into the other, researchers can pinpoint the specific residues responsible for functional differences. This approach has been successfully used to identify key amino acids constituting the carvone binding site in human OR1A1 and murine Olfr43 .

Comparative Pharmacology:
Testing both receptors with identical panels of odorants under standardized conditions can reveal differences in:

  • Ligand specificity

  • Potency (EC50 values)

  • Efficacy (maximum response)

  • Enantiomer selectivity

Homology Modeling and Docking Simulations:
Computational approaches can predict structural differences that might impact ligand binding:

  • Generate homology models for both human and chimpanzee OR1A1

  • Perform docking simulations with identical ligand sets

  • Analyze differences in binding energies and interaction patterns

  • Validate computational predictions through site-directed mutagenesis and functional assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.