Recombinant Pan troglodytes Palmitoyltransferase ZDHHC5 (ZDHHC5)

Shipped with Ice Packs
In Stock

Description

Functional Insights

ZDHHC5-mediated palmitoylation impacts diverse cellular processes:

Key Substrates and Roles

SubstrateFunctional RoleBiological ImpactReference
SSTR5Anti-proliferative receptor in pancreatic cellsEnhances membrane localization; targeted by Lomitapide
EZH2Histone methyltransferase in glioblastomaPromotes Golgi localization and oncogenic signaling
PKCδKinase in hypothalamic microgliaDrives neuroinflammation; inhibited by artemisinin
FAK1Focal adhesion kinaseEnhances EMT in glioblastoma

Mechanistic Regulation

  • Auto-Palmitoylation: Follows a ping-pong kinetic mechanism (Km=3.59 μMK_m = 3.59 \ \mu M, Vmax=39.55V_{max} = 39.55) .

  • Trafficking Control: Golga7b binding stabilizes ZDHHC5 at the plasma membrane, modulating endocytosis .

  • Pathological Links: Upregulated in glioblastoma and pancreatic cancer via p53/NF-Y transcriptional activation .

Research Applications

Recombinant ZDHHC5 is pivotal for:

Drug Discovery

  • Lomitapide Repurposing: Blocks ZDHHC5-SSTR5 interaction (Kd=509 nMK_d = 509 \ nM), suppressing pancreatic cancer proliferation .

  • Artemisinin: Inhibits PKCδ palmitoylation, attenuating neuroinflammation .

Disease Mechanisms

  • Glioblastoma: ZDHHC5 stabilizes PD-L1 and EZH2, driving immune evasion and stemness .

  • Cardiac Hypertrophy: Dynamic ZDHHC5 expression correlates with NCX1 palmitoylation in heart failure .

Comparative Analysis with Human ZDHHC5

FeaturePan troglodytes ZDHHC5Human ZDHHC5
Catalytic EfficiencyKm=3.59 μMK_m = 3.59 \ \mu M Similar kinetics inferred
Substrate SpecificityOverlaps with human substrates (e.g., SSTR5)Broader range (STAT3, δ-catenin)
Regulatory PathwaysConserved Golga7b interaction Additional roles in synaptic plasticity

Challenges and Future Directions

  • Structural Resolution: Full-length Pan troglodytes ZDHHC5 structures are needed to refine substrate docking models .

  • Species-Specific Roles: Functional divergence in immune or neural pathways remains unexplored .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ZDHHC5; Palmitoyltransferase ZDHHC5; Zinc finger DHHC domain-containing protein 5; DHHC-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSG VRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV SRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSL EITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSS SSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSP DFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHI VASLQEREKLLRQSPPLPVREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPL GRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTP KDEVQLKTTYSKSNGQPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV
Uniprot No.

Target Background

Function
Recombinant Pan troglodytes Palmitoyltransferase ZDHHC5 (ZDHHC5) is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It plays a role in diverse cellular processes, including palmitoylation of the G-protein coupled receptor SSTR5 and FLOT2.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ZDHHC5 palmitoyltransferase?

ZDHHC5 functions as a protein-acyl-transferase (PAT) that catalyzes S-palmitoylation, a reversible post-translational modification involving the covalent attachment of fatty acyl chains, typically palmitate (C16:0), to internal cysteine residues of proteins via thioester linkages. This modification is critical for regulating protein localization, stability, and function across various cellular processes . In specific contexts, ZDHHC5 has been shown to facilitate the palmitoylation of substrates like phospholemman (PLM) by recruiting interaction partners such as the Na-pump α subunit to a specific region on ZDHHC5 containing a juxtamembrane amphipathic helix . This substrate-specific recruitment mechanism represents a key aspect of how ZDHHC5 achieves specificity in its palmitoylation targets.

How does ZDHHC5 differ from other members of the ZDHHC family?

ZDHHC5 belongs to the zinc finger Asp-His-His-Cys-type (ZDHHC) family, which comprises 23 distinct genes in mammals (ZDHHC1-ZDHHC24, excluding ZDHHC10) . While all family members function as palmitoyl transferases, ZDHHC5 appears to have specialized roles in certain contexts. For instance, unlike other family members, ZDHHC5 demonstrates specific interaction with the Na-pump α subunit through its juxtamembrane amphipathic helix, mediating PLM palmitoylation . Additionally, while some ZDHHCs like ZDHHC11, ZDHHC22, and ZDHHC23 show altered expression patterns in gliomas (downregulated), ZDHHC5 does not show significant differential expression in these contexts .

What specific structural features enable ZDHHC5 to recognize its substrates?

ZDHHC5 contains a juxtamembrane amphipathic helix that serves as a critical substrate recruitment domain. Research has demonstrated that this helix undergoes site-specific palmitoylation and GlcNAcylation, which increases binding affinity between ZDHHC5 and its substrates, such as the Na-pump in the case of PLM palmitoylation . This structural feature allows ZDHHC5 to achieve substrate specificity by facilitating protein-protein interactions that bring substrate proteins into proximity with the catalytic domain. Disruption of these interactions, for example using cell-penetrating peptides that target the interaction interface, has been shown to reduce ZDHHC5-mediated palmitoylation .

What are the established methods for detecting and measuring ZDHHC5-mediated protein palmitoylation?

Researchers investigating ZDHHC5-mediated palmitoylation employ several complementary techniques:

  • Acyl-PEG Exchange (APE) Assay: This technique allows for detection of palmitoylated proteins in cell lines like U251 and T98G. The assay involves exchanging the palmitoyl group with a PEG moiety of known size, causing a detectable mobility shift during gel electrophoresis .

  • Metabolic Incorporation Assay: This approach utilizes metabolic labeling with palmitate analogs that can be detected or visualized. This method has been successfully employed to identify both the potential palmitoyl acyltransferase and specific palmitoylation sites on substrates like FAK .

  • Pharmacological Inhibition: 2-bromopalmitate (2-BP) can be used to inhibit cellular palmitoylation broadly, after which researchers can assess changes in palmitoylation status and cellular localization of suspected ZDHHC5 substrates .

  • Genetic Manipulation: RNA interference approaches using shRNA or siRNA targeting ZDHHC5 allow researchers to examine the effects of ZDHHC5 knockdown on substrate palmitoylation. Specific ZDHHC5 shRNA sequences that have proven effective include: 5'-CACCGGAAGCATTAGTGTTGACTGGCGAACCAGTCAACACTAATGCTTCC-3' and 5'-CACCGAAATCAAGCCTGACGAAGTTCGAAAACTTCGTCAGGCTTGATTTC-3' .

What experimental approaches can be used to identify and validate novel ZDHHC5 substrates?

Identifying and validating novel ZDHHC5 substrates involves a multi-step approach:

  • Candidate Substrate Screening: Initial identification can be performed through metabolic incorporation assays combined with mass spectrometry to identify proteins that lose palmitoylation when ZDHHC5 is inhibited or knocked down .

  • Site Identification: Once potential substrates are identified, site-directed mutagenesis of cysteine residues combined with palmitoylation assays can identify specific modification sites. For example, FAK was found to be palmitoylated by ZDHHC5 at Cys456 .

  • Functional Validation: To confirm the biological relevance of ZDHHC5-mediated palmitoylation, researchers should assess the functional consequences of preventing palmitoylation. This can include examining changes in:

    • Protein subcellular localization (e.g., membrane vs. cytoplasmic distribution)

    • Protein activity (e.g., phosphorylation status)

    • Downstream signaling events

    • Cellular phenotypes relevant to the substrate's function

For example, inhibiting FAK palmitoylation resulted in redistribution from membrane to cytoplasm and decreased phosphorylation .

How can researchers effectively manipulate ZDHHC5 activity in experimental settings?

Several approaches allow researchers to manipulate ZDHHC5 activity:

  • Pharmacological Inhibition: 2-bromopalmitate (2-BP) serves as a broad-spectrum inhibitor of protein palmitoylation and can be used to inhibit ZDHHC5 along with other palmitoyl transferases .

  • Genetic Knockdown/Knockout: shRNA or siRNA targeting ZDHHC5 can effectively reduce its expression. Validated sequences for ZDHHC5 knockdown have been published and demonstrated to abrogate S-palmitoylation and membrane distribution of ZDHHC5 substrates .

  • Peptide-Based Interference: Cell-penetrating peptides that disrupt specific protein-protein interactions between ZDHHC5 and its substrates can selectively reduce palmitoylation of specific targets. For instance, peptides disrupting the ZDHHC5-Na-pump interaction reduced PLM palmitoylation .

  • Overexpression Studies: Transfection with ZDHHC5 expression plasmids can be used to investigate the effects of increased ZDHHC5 activity on substrate palmitoylation and downstream cellular processes .

What role does ZDHHC5 play in cancer progression, particularly in glioblastoma?

ZDHHC5 has emerged as a significant contributor to cancer progression, with particularly strong evidence in glioblastoma (GBM):

  • FAK Palmitoylation: ZDHHC5 catalyzes the S-palmitoylation of Focal Adhesion Kinase (FAK) at Cys456, which is crucial for FAK's membrane localization and activation. This modification promotes cell proliferation, invasion, and epithelial-mesenchymal transition (EMT) in glioblastoma cells .

  • Stem Cell Regulation: ZDHHC5 increases the self-renewal capability of glioblastoma stem cells (GSCs), actively contributing to the tumorigenicity of glioma cells .

  • EZH2 Palmitoylation: ZDHHC5-mediated EZH2 palmitoylation has been shown to drive p53-mutant glioma malignant development and progression .

  • Tumor Growth Regulation: Knockdown of ZDHHC5 impairs cell proliferation, invasion, and EMT in glioblastoma, suggesting its importance in maintaining aggressive tumor phenotypes .

Experimental evidence indicates that targeting the ZDHHC5/FAK axis has potential as a therapeutic strategy for glioblastoma .

How does inhibition of ZDHHC5 affect tumor-associated immune cells?

Emerging evidence suggests that ZDHHC5 and other ZDHHCs play roles in regulating the tumor immune microenvironment:

  • Microglial Infiltration: Inhibition of ZDHHCs with 2-bromopalmitate (2-BP) weakens the migratory ability of microglia induced by glioma cells both in vitro and in vivo . This suggests that ZDHHC-mediated palmitoylation may regulate immune cell recruitment to tumor sites.

  • Immune Cell Function: Though not specific to ZDHHC5, the ZDHHC family has been implicated in immune regulation. For example, in colorectal cancer, ZDHHC3 promotes PD-L1 palmitoylation, which weakens T cell immune responses against tumors .

  • Therapeutic Implications: Targeting ZDHHCs may suppress both glioma cell viability and microglial infiltration, suggesting a dual effect on tumor cells and the tumor microenvironment that could enhance therapeutic efficacy .

While these findings implicate the broader ZDHHC family in immune regulation, further research is needed to elucidate ZDHHC5-specific effects on tumor-associated immune cells.

How does ZDHHC5 contribute to therapy resistance in cancers?

ZDHHC5 appears to contribute to therapy resistance through several mechanisms:

  • Chemotherapy Sensitivity: Inhibition of ZDHHCs has been shown to promote the sensitivity of glioma cells to temozolomide (TMZ) chemotherapy . This suggests that ZDHHC5 activity may normally confer resistance to standard therapies.

  • Cell Survival Pathways: ZDHHC5-mediated palmitoylation regulates key proteins involved in cell survival. For instance, ZDHHC5 ensures FAK membrane localization and activation, which promotes anti-apoptotic signaling that can protect cancer cells from therapy-induced death .

  • Cancer Stem Cell Maintenance: Through its role in promoting self-renewal of glioblastoma stem cells , ZDHHC5 likely contributes to therapy resistance, as cancer stem cells are known to be more resistant to conventional therapies.

While some ZDHHC family members like ZDHHC17 have been directly linked to chemotherapy resistance through targeting JNK and p38 MAPK pathways , additional research is needed to fully characterize ZDHHC5-specific mechanisms of therapy resistance.

What is the mechanism by which ZDHHC5 regulates substrate membrane localization?

ZDHHC5 regulates substrate membrane localization through a palmitoylation-dependent mechanism that affects protein trafficking and retention:

  • Hydrophobicity Increase: The addition of palmitate groups by ZDHHC5 increases protein hydrophobicity, facilitating membrane association. When FAK palmitoylation is inhibited, FAK redistributes from the membrane to the cytoplasm, demonstrating the direct relationship between palmitoylation and membrane localization .

  • Substrate-Specific Recruitment: ZDHHC5 contains a juxtamembrane amphipathic helix that recruits specific substrates. This recruitment brings substrates into proximity with the catalytic domain, enabling efficient palmitoylation . The site-specific modification of this helix enhances substrate binding, suggesting a regulatory mechanism for controlling the palmitoylation process.

  • Palmitoylation Site Specificity: ZDHHC5 palmitoylates specific cysteine residues on target proteins, such as Cys456 on FAK. This site-specific modification is crucial for proper membrane localization and subsequent activation of the substrate .

  • Cooperative Protein Interactions: ZDHHC5 may work cooperatively with other proteins to facilitate membrane recruitment. For example, in the case of PLM palmitoylation, ZDHHC5 interacts with the Na-pump α subunit, creating a complex that enables efficient PLM palmitoylation .

How do post-translational modifications regulate ZDHHC5 activity?

ZDHHC5 activity is itself regulated by various post-translational modifications, creating a complex regulatory network:

  • Auto-palmitoylation: Evidence suggests that ZDHHC enzymes, including ZDHHC5, undergo auto-palmitoylation as part of their catalytic cycle. This modification may be necessary for enzyme activity and stability .

  • GlcNAcylation: The juxtamembrane amphipathic helix of ZDHHC5 undergoes GlcNAcylation, which increases binding between ZDHHC5 and its substrates such as the Na-pump. This modification works in concert with palmitoylation to enhance substrate recruitment and subsequent palmitoylation efficiency .

  • Site-Specific Palmitoylation: The juxtamembrane amphipathic helix of ZDHHC5 is itself subject to site-specific palmitoylation, which increases binding affinity for certain substrates. This creates a potential feedback mechanism where ZDHHC5 activity could be self-regulated through its own palmitoylation status .

These modifications create a sophisticated regulatory system where ZDHHC5 activity can be fine-tuned in response to cellular conditions, potentially allowing for context-specific control of substrate palmitoylation.

What signaling pathways interact with or are affected by ZDHHC5-mediated palmitoylation?

ZDHHC5-mediated palmitoylation affects multiple signaling pathways critical for cellular function and disease progression:

  • FAK/EMT Signaling Axis: ZDHHC5 palmitoylates FAK, ensuring its membrane localization and activation, which promotes epithelial-mesenchymal transition (EMT). This involves altered expression of epithelial markers (E-cadherin, Occludin) and mesenchymal markers (Vimentin, N-cadherin) .

  • PI3K/AKT Pathway: Bioinformatic analysis suggests that ZDHHCs, including ZDHHC5, might exert their effects through the phosphatidylinositol 3-kinase/protein kinase B (PI3K/AKT) signaling pathway in gliomas .

  • Na/K-ATPase Regulation: ZDHHC5-mediated palmitoylation of phospholemman (PLM) affects the function of the Na-pump (Na/K-ATPase), an essential ion transporter that maintains cellular electrochemical gradients .

  • Autophagy Regulation: Inhibition of ZDHHCs with 2-bromopalmitate suppresses autophagy in glioma cells, suggesting that ZDHHC-mediated palmitoylation, potentially including ZDHHC5, regulates autophagy pathways .

Understanding these pathway interactions is crucial for predicting the consequences of targeting ZDHHC5 in therapeutic contexts.

What are the challenges in working with recombinant Pan troglodytes ZDHHC5?

Working with recombinant Pan troglodytes ZDHHC5 presents several technical challenges:

  • Expression and Purification: As a membrane-associated enzyme with multiple transmembrane domains, ZDHHC5 can be challenging to express and purify in active form. Researchers must carefully select expression systems that maintain proper protein folding and post-translational modifications .

  • Activity Assessment: Verifying enzymatic activity of recombinant ZDHHC5 requires reliable palmitoylation assays, such as metabolic incorporation assays or acyl-PEG exchange assays, which must be optimized for in vitro applications when using purified recombinant enzyme .

  • Substrate Availability: Testing recombinant ZDHHC5 activity requires access to properly folded substrate proteins, which may themselves be challenging to produce in recombinant form, particularly for membrane-associated substrates.

  • Comparative Analysis: When using Pan troglodytes ZDHHC5 as a model for human ZDHHC5 function, researchers must consider potential species-specific differences in substrate recognition or activity that could affect experimental interpretation.

How can recombinant Pan troglodytes ZDHHC5 be used in drug development research?

Recombinant Pan troglodytes ZDHHC5 offers several valuable applications in drug development research:

  • High-throughput Screening: Purified recombinant ZDHHC5 can be used in biochemical assays to screen for small molecule inhibitors that might have therapeutic potential in diseases where ZDHHC5 is implicated, such as glioblastoma .

  • Structure-Activity Relationship Studies: Recombinant protein can facilitate structural studies to understand the enzyme's active site and substrate-binding pockets, informing rational drug design approaches.

  • Cross-Species Validation: Testing potential inhibitors against both human and Pan troglodytes ZDHHC5 can provide insights into the evolutionary conservation of binding sites and help predict cross-species efficacy or toxicity.

  • Mechanism-Based Drug Design: Understanding the specific mechanisms by which ZDHHC5 facilitates substrate recruitment and palmitoylation, such as the role of its juxtamembrane amphipathic helix, can inspire peptide-based therapeutics that disrupt specific protein-protein interactions rather than catalytic activity .

  • Target Validation: Recombinant ZDHHC5 can be used in vitro to validate the specificity of candidate inhibitors before advancing to cell-based or in vivo testing, particularly for applications in cancer therapy where ZDHHC5 has been implicated in tumor progression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.