Recombinant Pan troglodytes Probable G-protein coupled receptor 33 (GPR33)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant GPR33 is produced via bacterial expression systems, followed by affinity chromatography using His-tag purification . Key protocols include:

  • Reconstitution: Lyophilized protein is solubilized in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage at -80°C .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C retain functionality for one week .

Role in Innate Immunity

GPR33 is highly expressed in dendritic cells and modulates immune responses through TLR/NF-κB/AP-1 signaling pathways . Experimental data show:

  • Upregulation by TLR agonists (e.g., LPS, poly I:C) and inflammatory mediators .

  • Inhibition by NF-κB blockers (celastrol) and AP-1 inhibitors (U-0126) .

Pseudogenization in Humans

GPR33 is a pseudogene in humans due to a premature stop codon. Evolutionary studies suggest:

  • Inactivation occurred independently in hominoids and rodents ~1 million years ago .

  • Selective pressure from pathogens (e.g., Plasmodium vivax) may have driven pseudogenization .

Research Applications

Recombinant GPR33 facilitates studies on:

  1. Immune Signaling: Investigating TLR/chemokine crosstalk in dendritic cells .

  2. Evolutionary Biology: Comparative analyses of GPCR pseudogenization across species .

  3. Structural Biology: Mapping ligand-binding domains using truncation mutants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR33; Probable G-protein coupled receptor 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQ TVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLS AIGLDRYLLTLHPVWSQQHRTPRWASSIVLGVWISAAALSIPYLIFRQTHHDRKGKVTCQ NNYAVSTNWESKEMQALRQWIHVACFISRFLLGFLLPFFIIIFCYERVASKVKERSLFKS SKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYL FVGENFKKVFKKSILALFESTFSEDSSVERTQT
Uniprot No.

Target Background

Function
Orphan receptor; could be a chemoattractant receptor.
Database Links

KEGG: ptr:746838

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR33 and what is its evolutionary significance?

GPR33 is an orphan member of the chemokine-like receptor family that first appeared in early mammalian genomes. Its evolutionary significance lies in its independent pseudogenization in multiple species including humans, other hominoids, and some rodent species, suggesting potential selection pressure related to pathogen interaction . The receptor is intact in many mammalian species but underwent inactivation in humans within the last million years, which is unlikely to be due to neutral drift alone . This pattern of pseudogenization across unrelated species suggests a selective advantage to carrying the null allele, possibly related to pathogen resistance.

How does GPR33 differ between humans and Pan troglodytes?

The key difference is that while Pan troglodytes (chimpanzee) has maintained a functional GPR33 gene, most humans carry a pseudogenized version containing a premature stop codon (SNP rs17097921, c.418T > C polymorphism) . This mutation converts a CGA (coding for arginine) to a TGA stop codon, resulting in a truncated, non-functional protein in humans . The fixation of this null allele in human populations, particularly in Europeans, suggests possible evolutionary advantages of GPR33 inactivation, potentially related to immune response modulation or pathogen resistance .

Where is GPR33 primarily expressed in mammalian systems?

GPR33 is highly expressed in dendritic cells (DCs), which are critical components of the innate immune system . This expression pattern supports the hypothesis that GPR33 plays a significant role in immune function, particularly in antigen presentation and immune cell communication. Expression has also been detected in other lymphoid tissues including spleen, thymus, and lymph nodes, with expression levels increasing significantly upon immune stimulation .

How is GPR33 expression regulated at the molecular level?

GPR33 expression is regulated by toll-like receptor (TLR) activation and AP-1/NF-κB signaling pathways . Bioinformatic analysis of the GPR33 promoter region has revealed several AP-1 and NF-κB transcription factor binding sites, confirming the molecular basis for this regulation . Compounds that stimulate TLRs (such as LPS, poly I:C, R-848, and zymosan A) significantly increase GPR33 mRNA expression, as do activators of AP-1 and NF-κB signaling cascades like chloroquine and PMA .

What experimental approaches should be used to study GPR33 expression regulation?

For studying GPR33 expression regulation, researchers should consider:

  • In vitro stimulation with TLR activators: Treating dendritic cells or other relevant cell types with compounds like poly I:C (TLR3 activator), R-848 (TLR7 activator), LPS, or zymosan A, followed by measurement of GPR33 mRNA levels at various time points (optimal at 8 hours post-stimulation) .

  • In vivo models: Administering TLR activators to animal models (intraperitoneal or nasal application routes) and harvesting tissues such as spleen, thymus, lymph nodes, and lungs after 9 hours for GPR33 expression analysis .

  • Promoter analysis: Investigating the transcriptional regulation through analysis of the AP-1 and NF-κB binding sites in the GPR33 promoter region .

  • Time-course experiments: Conducting time-course analyses to determine optimal expression windows, as GPR33 shows maximal expression approximately 8 hours after poly I:C stimulation .

What expression systems are optimal for recombinant GPR33 production?

E. coli has been successfully used as an expression system for recombinant Pan troglodytes GPR33 . For optimal expression, the full-length protein (amino acids 1-333) should be fused to an N-terminal His-tag to facilitate purification without compromising functionality . When expressing GPR33 in E. coli, researchers should expect protein yields that allow for greater than 90% purity as determined by SDS-PAGE .

What are the recommended storage and handling protocols for recombinant GPR33 protein?

Recombinant GPR33 protein should be stored according to the following protocol:

  • Initial storage: Store the lyophilized powder at -20°C/-80°C upon receipt .

  • Reconstitution: Prior to opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: Add glycerol to a final concentration of 5-50% (optimally 50%) and aliquot for long-term storage at -20°C/-80°C .

  • Working storage: For short-term use, working aliquots can be stored at 4°C for up to one week .

  • Avoid degradation: Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What quality control methods should be employed when working with recombinant GPR33?

When working with recombinant GPR33, researchers should implement the following quality control measures:

  • Purity assessment: SDS-PAGE analysis should confirm greater than 90% purity .

  • Structural integrity verification: Circular dichroism or other structural analyses can verify proper protein folding.

  • Functional testing: Binding assays or signaling tests should be performed to confirm receptor functionality.

  • Stability monitoring: Regular aliquot testing over time to ensure storage conditions maintain protein integrity.

  • Batch-to-batch consistency: Comparison of different production batches to ensure reproducible quality and experimental outcomes.

These quality control measures are essential for ensuring reliable and reproducible experimental results when working with this complex membrane protein.

What evidence supports GPR33's role in innate immunity?

Multiple lines of evidence support GPR33's involvement in innate immunity:

  • Expression pattern: High expression in dendritic cells, which are critical mediators of innate immune responses .

  • Response to immune stimulation: Significant upregulation following TLR activation, which is a hallmark of innate immune activation .

  • Regulatory pathways: Regulation by AP-1/NF-κB signaling pathways, which are central to immune response coordination .

  • In vivo response: Increased expression in lymphoid tissues following administration of immune stimulants that mimic viral infections (poly I:C, R-848) .

  • Evolutionary pattern: Independent pseudogenization in multiple species suggests interaction with pathogens, a key selective pressure on immune genes .

These findings collectively position GPR33 as an early transcriptional target in the innate immune response, particularly in response to viral challenges .

How does GPR33 interact with toll-like receptor signaling pathways?

GPR33 appears to be downstream of toll-like receptor signaling pathways rather than directly interacting with them. Experimental evidence shows that:

  • TLR activators including LPS (TLR4), poly I:C (TLR3), R-848 (TLR7), and zymosan A significantly increase GPR33 mRNA expression in vitro .

  • This regulation occurs via AP-1 and NF-κB signaling cascades, which are activated downstream of TLR stimulation .

  • In vivo administration of poly I:C (TLR3 activator) and R-848 (TLR7 activator) elevates GPR33 expression in lymphoid organs within 9 hours .

  • Bioinformatic analysis confirms that the GPR33 promoter contains binding sites for transcription factors activated by TLR signaling .

This relationship positions GPR33 as a potential amplifier or modulator of TLR-initiated immune responses, particularly in the context of viral detection and response.

What experimental models are most appropriate for studying GPR33's immunological functions?

Based on the available data, the following experimental models are recommended for studying GPR33's immunological functions:

  • Dendritic cell cultures: Primary dendritic cells or dendritic cell lines represent the most physiologically relevant in vitro model due to high GPR33 expression .

  • TLR stimulation assays: Treatment with TLR activators (poly I:C, R-848, LPS, zymosan A) provides a framework for studying GPR33 regulation during immune responses .

  • Mouse models: Intraperitoneal or nasal application of TLR activators in mice, followed by analysis of lymphoid tissues, provides an effective in vivo model .

  • Comparative species models: Studying GPR33 function in species with intact versus pseudogenized alleles can provide evolutionary insights.

  • Knockout/knockin systems: Creating GPR33 knockout models or humanized models (with the pseudogene) in species with functional GPR33 could elucidate its specific role in immune protection or susceptibility.

These models allow for comprehensive investigation of GPR33's role in both steady-state and stimulated immune conditions.

What are the population differences in GPR33 allele frequencies?

Significant differences in GPR33 allele frequencies exist between human populations:

These population differences suggest potential regional selective pressures affecting GPR33 functionality, possibly related to pathogen exposure or other environmental factors specific to different geographical regions .

What evolutionary mechanisms explain GPR33 pseudogenization?

Several evolutionary mechanisms have been proposed to explain GPR33 pseudogenization:

  • Pathogen-driven selection: The simultaneous pseudogenization in several unrelated species within the last 1 million years suggests selection related to a rodent-hominoid-specific pathogen .

  • Balancing selection: The maintenance of both functional and non-functional alleles in some populations could indicate balancing selection, where heterozygosity provides an advantage .

  • Past selective events: While recent tests (Tajimas's D, Fu and Li's D* and F* tests) don't show signatures of very recent selection (last 10-50,000 years), the data is consistent with older selective events .

  • Geographic selection patterns: The near fixation of the null-allele in European populations suggests potential regional selection related to specific environmental or pathogen pressures .

The pattern of pseudogenization is inconsistent with neutral drift, supporting the hypothesis that inactivation of GPR33 provided some selective advantage, potentially by preventing pathogen entry or modulating immune responses .

How can researchers analyze GPR33 genetic variation in population studies?

Researchers studying GPR33 genetic variation should employ the following methodological approaches:

  • SNP genotyping: Use TaqMan® allelic discrimination assay to genotype individuals at SNP rs17097921 (c.418T > C polymorphism), which distinguishes between the TGA (pseudogene) and CGA (intact gene) allelic variants .

  • Population data analysis: Utilize public data resources such as HapMap SNP data collections and Perlegen's reference genotype data (AFD panels) for broader population analyses .

  • Selection signature testing: Apply multiple statistical tests including:

    • iHS scores and Fst values to detect recent selection

    • Tajima's D test to detect departures from neutral evolution

    • Fu and Li's D* and F* tests to identify selective sweeps

  • Bioinformatic tools: Use tools like DnaSP for comprehensive population genetic analysis .

  • Comparative genomics: Compare GPR33 sequences across different species to identify patterns of conservation or divergence that might indicate functional importance.

When analyzing results, researchers should consider different timeframes of selection, as absence of very recent selection signatures doesn't exclude selection in the more distant past (>50,000 years ago) .

How can recombinant GPR33 be used to identify potential ligands?

To identify potential ligands for GPR33, researchers should consider these methodological approaches:

  • Binding assays: Use purified recombinant GPR33 in direct binding assays with candidate ligands, particularly those related to immune signaling molecules.

  • Receptor activation assays: Employ cellular systems expressing recombinant GPR33 and measure downstream signaling (calcium mobilization, cAMP production, or MAPK activation) in response to candidate ligands.

  • Chemokine library screening: Given GPR33's classification as a chemokine-like receptor, systematic screening of chemokine libraries could identify potential ligands.

  • Comparative pharmacology: Leverage knowledge of ligands for related receptors to identify potential GPR33 ligands through structural and functional similarities.

  • Computational approaches: Use in silico docking studies and molecular modeling to predict ligand interactions with the GPR33 binding pocket.

Since GPR33 remains an orphan receptor, identification of its natural ligand(s) would significantly advance understanding of its physiological role in immunity.

What are the implications of GPR33 research for understanding human susceptibility to infections?

Research on GPR33 has several implications for understanding human susceptibility to infections:

  • Evolutionary trade-offs: The pseudogenization of GPR33 in humans may represent an evolutionary trade-off, potentially protecting against specific pathogens that might use GPR33 as an entry point, while possibly compromising other immune functions .

  • Population susceptibility differences: The varied distribution of functional and non-functional GPR33 alleles across human populations may contribute to differential susceptibility to certain infectious diseases .

  • Viral immunity: The strong upregulation of GPR33 in response to viral mimetics (poly I:C, R-848) suggests a particular role in antiviral immunity that may be altered in humans with the pseudogene .

  • Dendritic cell function: As GPR33 is highly expressed in dendritic cells, its absence in humans may affect dendritic cell migration, maturation, or antigen presentation capabilities .

  • Historic pathogen pressure: The pattern of GPR33 inactivation may provide insights into historic pathogen pressures on human populations, particularly in European regions where the null-allele is near fixation .

Understanding these implications could contribute to developing personalized approaches to infectious disease prevention and treatment based on GPR33 status.

How can contradictory findings about GPR33 function be reconciled in research?

When facing contradictory findings about GPR33 function, researchers should:

  • Consider species differences: Compare results obtained from different species, recognizing that GPR33 function may vary between species with intact versus pseudogenized genes.

  • Examine experimental conditions: Evaluate how differences in experimental models, cell types, stimulation protocols, or timing might contribute to contradictory results.

  • Assess expression levels: Verify that the expression level of GPR33 in experimental systems matches physiological levels in relevant tissues.

  • Integrate multiple approaches: Combine in vitro, in vivo, and in silico approaches to build a more comprehensive understanding of GPR33 function.

  • Apply systems biology: Use network analysis to place GPR33 in the broader context of immune signaling pathways, which may reveal context-dependent functions.

By systematically addressing these factors, researchers can develop a more nuanced understanding of GPR33's complex role in immunity that accommodates seemingly contradictory findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.