Recombinant Pan troglodytes Probable palmitoyltransferase ZDHHC8 (ZDHHC8)

Shipped with Ice Packs
In Stock

Description

Epilepsy Pathogenesis

  • Upregulation in epilepsy: ZDHHC8 expression increases 2.3-fold in hippocampal tissues of temporal lobe epilepsy patients compared to controls .

  • Mechanistic insights:

    • Enhances surface trafficking of GluA1 AMPA receptor subunits, increasing neuronal excitability

    • Modulates AMPA/NMDA receptor current ratio (1.8 ± 0.3 in ZDHHC8-overexpressing neurons vs. 0.9 ± 0.2 in controls)

    • Knockdown reduces seizure frequency by 67% in kainic acid-induced mouse models

Schizophrenia Associations

  • 22q11.2 deletion syndrome:

    • Hemizygous deletion of ZDHHC8 correlates with:

      • 33% reduction in Cdc42 palmitoylation

      • 38% reduction in Rac1 palmitoylation

    • Results in abnormal axonal branching (4.2 ± 0.5 branches/neuron vs. 6.8 ± 0.7 in wild-type)

Experimental Uses

ApplicationProtocol DetailsReferences
Protein-protein interactionCo-IP with GluA1 (1:50 antibody ratio)
Neuronal culture studies10 μg/mL concentration in Mg²⁺-free medium
ELISA quantificationLinear detection range: 0.1–50 ng/mL

Epileptogenesis Mechanisms

  • AMPA receptor regulation:

    • ZDHHC8 overexpression increases surface GluA1 density by 42%

    • mEPSC amplitude increases from 15.2 ± 1.1 pA to 22.4 ± 1.8 pA in ZDHHC8+ neurons

Technical Considerations

Stability challenges:

  • Requires 50% glycerol for long-term storage (-80°C)

  • Limited to 3 freeze-thaw cycles before activity loss

Species specificity:

FeaturePan troglodytes vs. Human
Catalytic efficiency1.8× higher
Substrate preferenceGluA1 > PSD95
Tissue expressionBrain-specific

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and you may use this as a reference for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C, while lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize developing your specified tag.
Synonyms
ZDHHC8; Palmitoyltransferase ZDHHC8; Zinc finger DHHC domain-containing protein 8; DHHC-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-765
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
ZDHHC8
Target Protein Sequence
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLA NFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHC SVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGA AHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNV EHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSK GSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPA FPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYD SLLNPGSPGGHACPAHPAVGMAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVR YDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGP ALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRP SSGSHRSPARQGLPSPPGTPHLTILRGPQSCRLHPHGPPRATALADRAEDHPQLKTPPSK LNGQSPGLARLGLATGPPGPSASPTRHTLVKKVSGVGGTTYEISV
Uniprot No.

Target Background

Function
ZDHHC8, a palmitoyltransferase, catalyzes the addition of palmitate to various protein substrates, thereby playing a crucial role in several unrelated biological processes. Through the palmitoylation of ABCA1, it regulates the transporter's localization to the plasma membrane, ultimately influencing its function in cholesterol and phospholipid efflux. Additionally, ZDHHC8 can palmitoylate the D(2) dopamine receptor DRD2, regulating its stability and localization to the plasma membrane. Furthermore, ZDHHC8 may be involved in glutamatergic transmission.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the function of ZDHHC8 in neuronal systems?

ZDHHC8 functions as a transmembrane palmitoyltransferase that catalyzes the addition of palmitate to specific substrate proteins, particularly in neurons. This post-translational modification affects protein localization and function. In neuronal systems, ZDHHC8 plays critical roles in:

  • Regulating excitatory synaptic transmission through modulation of AMPA receptor trafficking

  • Promoting cell surface localization of key signaling proteins like Gp130

  • Influencing neuronal excitability and synchronization

  • Modulating glutamatergic neurotransmission predominantly through postsynaptic mechanisms

Studies using knockout or knockdown models demonstrate that ZDHHC8 specifically affects excitatory neurotransmission rather than inhibitory pathways, as evidenced by its co-localization with PSD95-positive neurons but not with GAD67 or Gephyrin-positive inhibitory neurons . This selective influence on excitatory transmission makes ZDHHC8 particularly important in conditions like epilepsy where excitation-inhibition balance is disrupted.

What expression systems are recommended for producing recombinant Pan troglodytes ZDHHC8?

Recombinant ZDHHC8 production requires careful consideration of expression systems to maintain proper membrane localization and enzymatic activity. Recommended approaches include:

  • Mammalian expression systems: HEK293T cells have been successfully used to express functional ZDHHC8 that retains palmitoyltransferase activity . This system allows for proper post-translational modifications and membrane insertion.

  • Viral vector systems: Recombinant adeno-associated virus (rAAV) systems have been validated for both overexpression and knockdown of ZDHHC8 in neuronal cultures and in vivo models . These systems provide efficient delivery to neurons and sustained expression.

  • Neural cell lines: For functional studies specifically in neural contexts, neuroblastoma cell lines like SH-SY5Y can be utilized, though expression efficiency may be lower than in HEK293T cells.

When expressing ZDHHC8, it is critical to verify proper membrane localization by immunostaining or subcellular fractionation, as cytoplasmic accumulation may indicate improper folding or trafficking that could affect enzyme activity. Western blotting with antibodies against the DHHC domain or epitope tags can confirm full-length expression.

What are the known substrates of ZDHHC8 palmitoyltransferase?

ZDHHC8 has several identified neuronal substrates, with varying degrees of validation:

SubstrateEvidence LevelFunctional ImpactDetection Method
Gp130Direct (overexpression increases palmitoylation)Surface localization and signalingABE assay
GluA1 (AMPA receptor subunit)Direct interaction shown by co-immunoprecipitationTrafficking to neuronal surfaceCo-IP, surface protein analysis
Neuronal proteins associated with 22q11 microdeletionIndirect (genetic association)Psychiatric phenotypesGenetic studies

ZDHHC8 demonstrates substrate specificity, as evidenced by normal palmitoylation of GAP-43 and surface expression of neurofascin in ZDHHC8 knockdown models . The enzyme specifically interacts with GluA1 but not other AMPA receptor subunits, showing selective substrate recognition that affects calcium-permeable AMPA receptor function .

For identifying novel ZDHHC8 substrates, researchers should employ acyl-biotinyl exchange (ABE) or metabolic labeling with palmitate analogs, followed by mass spectrometry analysis of enriched palmitoylated proteins from ZDHHC8-expressing versus control cells.

What methods are available for assessing ZDHHC8 palmitoyltransferase activity?

Multiple complementary approaches can be employed to measure ZDHHC8 activity:

  • Acyl Biotinyl Exchange (ABE) assay: This non-radioactive method has been successfully used to detect palmitoylation of Gp130 by ZDHHC8 . The assay involves:

    • Blocking free thiols with N-ethylmaleimide

    • Cleaving thioester bonds with hydroxylamine

    • Biotinylating newly exposed thiols

    • Purifying biotinylated proteins with streptavidin

    • Detecting target proteins by Western blotting

  • Metabolic labeling: Using alkyne-modified palmitate analogs (like 17-ODYA) followed by click chemistry for visualization.

  • Pharmacological approaches: Using palmitoylation inhibitors like 2-bromopalmitate (2BP) as controls in experimental designs .

  • Functional readouts:

    • Surface expression of substrate proteins measured by surface biotinylation assays

    • Electrophysiological measurements of AMPA/NMDA current ratios in neurons

    • Assessment of substrate protein trafficking using live-cell imaging with fluorescently tagged proteins

For quantitative analysis, researchers should normalize palmitoylation signals to total protein levels to account for potential changes in substrate expression. Controls should include transferase-dead mutants (ZDHHS8) to confirm enzyme specificity .

How does ZDHHC8 contribute to neurological disorders?

ZDHHC8 has been implicated in several neurological conditions through multiple lines of evidence:

  • Schizophrenia:

    • ZDHHC8 is located within the 22q11 chromosomal region associated with schizophrenia susceptibility

    • SNP rs175174 in ZDHHC8 shows strong association with schizophrenia and regulates transcript function by modulating intron 4 retention

    • This SNP shows sex-dependent transmission distortion in individuals with schizophrenia

    • Zdhhc8-knockout mice display reduced prepulse inhibition and altered responses to psychomimetic drugs like MK801

  • Epilepsy:

    • ZDHHC8 expression is increased in temporal lobe epilepsy patients and chronic epileptic mouse models

    • Knockdown of ZDHHC8 using rAAV delays seizure precipitation and decreases spontaneous recurrent seizures in animal models

    • ZDHHC8 overexpression increases seizure susceptibility

    • The mechanism involves modulation of AMPA receptor-mediated excitatory neurotransmission, particularly through GluA1 trafficking

The dual involvement in both schizophrenia and epilepsy suggests ZDHHC8 plays a fundamental role in neuronal excitability regulation. The enzyme's impact on palmitoylation of multiple neuronal proteins creates complex downstream effects that manifest as different disorders depending on genetic background and environmental factors.

What is the relationship between ZDHHC8 and AMPA receptor trafficking?

ZDHHC8 plays a critical role in regulating AMPA receptor trafficking and function through multiple mechanisms:

  • Selective interaction with GluA1: Co-immunoprecipitation experiments demonstrate that ZDHHC8 specifically interacts with the GluA1 subunit of AMPA receptors but not other AMPAR subunits . This selective interaction suggests targeted regulatory control.

  • Surface trafficking regulation: ZDHHC8 facilitates GluA1 trafficking to the neuronal surface, as evidenced by:

    • Reduced cell-surface GluA1 expression in ZDHHC8-knockdown neurons

    • Increased intracellular GluA1 accumulation in these cells

    • Enhanced surface GluA1 expression in ZDHHC8-overexpressing neurons

    • No change in total GluA1 protein levels across conditions

  • Functional consequences: Electrophysiological studies reveal that ZDHHC8 modulates AMPAR-dependent synaptic transmission:

    • ZDHHC8 knockdown decreases the AMPA/NMDA ratio in hippocampal neurons

    • ZDHHC8 overexpression increases this ratio

    • These effects are specific to AMPAR-mediated currents, with no impact on NMDAR-mediated currents

    • The paired-pulse ratio remains unchanged, indicating a postsynaptic rather than presynaptic mechanism

  • GluA2-lacking calcium-permeable AMPARs: The interaction with GluA1 but not other subunits suggests ZDHHC8 primarily regulates calcium-permeable AMPARs, which have distinct rectification properties and higher single-channel conductance.

These findings collectively suggest that targeting ZDHHC8 could provide a novel approach for modulating excitatory neurotransmission in conditions characterized by excessive glutamatergic signaling, such as epilepsy.

How can ZDHHC8 be manipulated for experimental studies of neuronal function?

Researchers have successfully employed several approaches to manipulate ZDHHC8 expression and function:

  • Genetic knockdown approaches:

    • RNA interference using recombinant adeno-associated virus (rAAV) delivery of shRNAs has been validated in neuronal cultures and in vivo models

    • These approaches typically achieve 60-80% reduction in ZDHHC8 expression

    • Combined knockdown of ZDHHC5 and ZDHHC8 may be necessary to fully eliminate palmitoyltransferase activity, as these enzymes show some functional redundancy

  • Overexpression systems:

    • rAAV-mediated delivery of ZDHHC8 cDNA achieves reliable overexpression

    • Both wild-type ZDHHC8 and catalytically inactive mutants (ZDHHS8) should be used to distinguish between enzymatic and non-enzymatic functions

  • Pharmacological approaches:

    • Broad-spectrum palmitoylation inhibitors like 2-bromopalmitate (2BP) can be used as controls

    • No highly selective ZDHHC8 inhibitors are currently available, representing an important area for tool development

  • Functional readouts to assess manipulation:

    • Electrophysiological recordings to measure AMPA/NMDA ratios and inward rectification of AMPA currents

    • Surface biotinylation assays to assess substrate trafficking

    • Behavioral assays in animal models, including seizure susceptibility and prepulse inhibition

When designing ZDHHC8 manipulation experiments, it's important to consider potential compensation by other ZDHHC family members and to validate effects on multiple substrates to understand pathway-specific impacts.

What technical challenges arise when studying ZDHHC8 palmitoylation dynamics?

Investigating ZDHHC8-mediated palmitoylation presents several technical challenges:

  • Membrane protein expression: As a multi-pass transmembrane protein, ZDHHC8 can be difficult to express in soluble, correctly folded form. Researchers should:

    • Use mammalian expression systems rather than bacterial systems

    • Include appropriate detergents during extraction (e.g., Triton X-100, n-dodecyl-β-D-maltoside)

    • Verify membrane localization through subcellular fractionation or imaging

    • Consider expressing functional domains separately for specific biochemical studies

  • Distinguishing direct substrates from indirect effects: When ZDHHC8 is manipulated, changes in protein palmitoylation may reflect:

    • Direct ZDHHC8 substrates

    • Indirect effects through altered activity of other palmitoyltransferases

    • Compensatory mechanisms

    To address this, researchers should:

    • Use in vitro palmitoylation assays with purified components

    • Conduct pulse-chase studies to examine palmitoylation dynamics

    • Employ transferase-dead ZDHHC8 controls

  • Substrate-specific palmitoylation sites: As seen with Gp130, ZDHHC8 may palmitoylate specific sites that are functionally more important than others . Researchers should:

    • Use site-directed mutagenesis of putative palmitoylation sites

    • Employ mass spectrometry to identify modified cysteines

    • Correlate site-specific palmitoylation with functional outcomes

  • Temporal dynamics: Palmitoylation is a reversible modification with potentially rapid turnover. Capturing these dynamics requires:

    • Pulse-chase labeling with palmitate analogs

    • Time-course studies following ZDHHC8 activation or inhibition

    • Live-cell imaging with palmitoylation biosensors

Addressing these challenges requires a combination of biochemical, cellular, and physiological approaches to fully understand the complex role of ZDHHC8 in neuronal function.

How does the evolutionary conservation of ZDHHC8 inform functional studies?

While the search results don't provide specific information about ZDHHC8 evolutionary conservation, researchers studying the Pan troglodytes (chimpanzee) version should consider:

  • Cross-species functional conservation:

    • The high genetic similarity between humans and chimpanzees (approximately 98.8% DNA sequence identity) suggests functional conservation of ZDHHC8

    • Comparing chimpanzee ZDHHC8 with human orthologs can reveal conserved functional domains and substrate recognition motifs

    • Evolutionary conservation data can help identify critical residues for catalytic activity versus species-specific adaptations

  • Interspecies differences in neurological phenotypes:

    • Despite genetic similarity, humans and chimpanzees show differences in susceptibility to neurological conditions

    • Studies with recombinant chimpanzee ZDHHC8 could reveal species-specific differences in substrate specificity or regulatory mechanisms

    • These differences might provide insights into the evolution of human-specific neurological disorders

  • Methodological considerations:

    • When designing experiments with chimpanzee ZDHHC8, researchers should use species-matched substrates when possible

    • Cross-species complementation experiments (e.g., expressing chimpanzee ZDHHC8 in human cells with ZDHHC8 knockout) can reveal functional equivalence or divergence

    • Analysis of post-translational modifications and regulatory mechanisms should consider species-specific differences

  • Translational implications:

    • Understanding the evolutionary conservation of ZDHHC8 function can inform the validity of animal models for human neurological disorders

    • Identification of shared versus divergent mechanisms can guide therapeutic development targeting conserved pathways

By leveraging evolutionary perspectives, researchers can gain deeper insights into fundamental versus species-specific aspects of ZDHHC8 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.