Recombinant Pan troglodytes Sodium/potassium-transporting ATPase subunit beta-1 (ATP1B1)

Shipped with Ice Packs
In Stock

Description

Ion Transport Regulation

ATP1B1 ensures proper folding and plasma membrane trafficking of Na+/K+-ATPase α-subunits, maintaining electrochemical gradients essential for :

  • Cellular osmoregulation

  • Nerve/muscle electrophysiology

  • Sodium-coupled nutrient absorption

Antiviral Innate Immunity

Recent studies demonstrate ATP1B1’s role in enhancing antiviral responses:

  • Binds TRAF3/TRAF6 to amplify TBK1 and TAK1 phosphorylation, boosting IFN-β and ISG production

  • Knockdown reduces IFN-stimulated genes (ISGs) by 40–60%, increasing viral replication susceptibility

Disease Associations

ConditionMechanistic InsightReference
HypertensionATP1B1 polymorphisms alter mRNA polyadenylation, affecting renal sodium handling
Renal Cell Carcinoma (RCC)Promoter hypermethylation silences ATP1B1, correlating with tumor progression
Heart FailureAltered ATP1B1 expression disrupts cardiac myocyte calcium homeostasis

Experimental Uses

  • Viral Pathogenesis Studies: Investigating ATP1B1-TRAF3/6 interactions in DNA/RNA virus evasion mechanisms

  • Cancer Biomarker Research: Assessing ATP1B1 methylation status in RCC prognosis

  • Hypertension Models: Evaluating 3’UTR variants in primate blood pressure regulation

Technical Advantages

  • Multiple Expression Systems: Available in yeast (CSB-YP002326EQV1), E. coli (CSB-EP002326EQV1), and mammalian cells

  • Biotinylated Options: AviTag-conjugated versions enable pull-down assays (e.g., CSB-EP002326EQV1-B)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP1B1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKIGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Uniprot No.

Target Background

Function
This protein represents the non-catalytic component of the active enzyme, which catalyzes ATP hydrolysis coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates the number of sodium pumps transported to the plasma membrane by forming alpha/beta heterodimers. It also plays a role in cell adhesion and establishing epithelial cell polarity.
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.

Q&A

What expression systems are optimal for producing functional recombinant Pan troglodytes ATP1B1, and what purification challenges exist?

Recombinant ATP1B1 requires mammalian expression systems (e.g., HEK293 or CHO cells) due to its transmembrane domain and post-translational modifications. Prokaryotic systems like E. coli often fail to produce properly folded protein, as ATP1B1 requires β-subunit-specific glycosylation for Na+/K+-ATPase complex assembly . Key purification challenges include:

  • Detergent selection: Use n-dodecyl-β-D-maltoside (DDM) to maintain transmembrane stability while avoiding protein aggregation.

  • Affinity tagging: Histidine tags may interfere with native conformation; instead, employ Strep-tag II systems for improved compatibility with lipid bilayers .
    A typical yield ranges from 0.5–2 mg/L culture, with purity >90% achievable via sequential immobilized metal affinity chromatography (IMAC) and size-exclusion chromatography (SEC) .

How do researchers validate the structural integrity of recombinant ATP1B1 in vitro?

A multi-modal validation pipeline is essential:

TechniqueApplicationCritical Parameters
Circular Dichroism (CD)Secondary structure verificationα-helix content should match UniProt-predicted 45%
Surface Plasmon Resonance (SPR)Ligand-binding kineticsKD values for ouabain binding: 10–100 nM
Cryo-EM Single-Particle AnalysisQuaternary structureResolution <4Å required to resolve β1-α3 subunit interface

Discrepancies between predicted and observed molecular weights (e.g., 34 kDa calculated vs. 55 kDa on SDS-PAGE) typically arise from glycosylation .

What experimental strategies resolve contradictions in ATP1B1’s role across disease models?

Recent studies report conflicting roles:

  • Pro-survival in alveolar epithelium: ATP1B1 stabilizes HSP90AB1 interactions, enhancing barrier function (A549 cells) .

  • Oncogenic in leukemia: High expression correlates with poor prognosis (HR = 2.1, 95% CI: 1.3–3.4) .

Resolution methodology:

  • Context-specific knockdown: Use CRISPR/Cas9 in isogenic cell lines to compare epithelial vs. hematopoietic systems.

  • Interactome mapping: Co-IP-MS in A549 cells identified 159 ATP1B1 partners, including HSP90AB1 (fold change = 4.2) , whereas leukemia models show STAT1 co-regulation (β = 0.67, p < 0.01) .

  • Pathway enrichment: Epithelial models emphasize protein folding (GO:0006457, p = 3×10⁻⁵) , while leukemic models show cell cycle dysregulation (KEGG:04110, p = 0.002) .

How to design CRISPR-edited models for studying ATP1B1’s non-canonical roles in cell adhesion?

Stepwise protocol:

  • Guide RNA design: Target exon 2 (chr1:169,349,102–169,349,125, GRCh38) to disrupt β1-α subunit binding.

  • Phenotypic validation:

    • Transepithelial resistance (TER): ΔATP1B1 reduces TER by 63±8% in MDCK II cells .

    • Immunofluorescence: Loss of E-cadherin polarization (p < 0.001 vs. WT) .

  • Rescue experiments: Co-transfect ATP1B1-CFP and α1-YFP constructs to quantify FRET efficiency (>15% indicates functional complex restoration) .

What proteomic approaches characterize ATP1B1’s interactome under pathological stress?

Advanced workflow from recent studies :

  • Co-IP-MS: Anti-ATP1B1 antibody (ABclonal, A10284) with crosslinker (DSS, 2 mM).

  • PRM validation: Target 6 key interactors (HSP90AB1, EIF4A1, etc.) with heavy isotope-labeled peptides.

  • Network analysis:

    • Module 1: Ribosomal proteins (37 nodes, score = 37)

    • Module 2: Heat shock proteins (6 nodes, score = 6)

Key finding: HSP90AB1 knockdown reduces ATP1B1 stability by 72% (p = 0.008), confirming functional dependency .

How does ATP1B1’s expression profile inform biomarker development for respiratory/cancer therapies?

DiseaseExpression PatternClinical Correlation
ARDS↓50% in alveolar epitheliumCorrelates with edema clearance (r = 0.81)
CN-AML↑3.2-fold vs. normalOS HR = 1.9 (95% CI: 1.2–3.0)

Validation strategy:

  • Multiplex IHC: Co-stain ATP1B1 with CD31 (vascular leakage) or CD34 (leukemic blasts).

  • Digital pathology: QuPath analysis of H-score variance (Δ >30% indicates prognostic significance) .

Why do ATP1B1 structure determinations yield conflicting topology models?

Discrepancies arise from:

  • Glycosylation artifacts: PNGase F treatment reduces extracellular domain resolution by 1.8Å .

  • Detergent bias: DDM preserves helix orientation but obscures residues 89–101 vs. LMNG .
    Consensus approach: Hybridize cryo-EM (EMDB-3567) with molecular dynamics simulations (NAMD 3.0) to resolve extracellular loop conformations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.