Recombinant Pan troglodytes Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Functional and Research Applications

ST7 belongs to the LDLR (Low-Density Lipoprotein Receptor) superfamily and contains two CUB domains and five LDLR class A domains in its extracellular domain (ECD) . These structural motifs mediate interactions with ligands such as LRPAP (lipoprotein receptor-associated protein), as demonstrated in binding assays .

Key Research Findings

  1. Binding Interactions

    • Recombinant ST7 binds LRPAP with an EC₅₀ of 0.6–3 µg/mL when immobilized at 0.5 µg/mL .

    • The ECD (460 aa) facilitates ligand recognition, while the cytoplasmic domain (346 aa) contains motifs for endocytosis and signal transduction .

  2. Cancer Biology

    • ST7 expression is not consistently downregulated in cancers, challenging its classification as a tumor suppressor .

    • Genomic studies in primates (e.g., gibbon) highlight conserved synteny but accelerated chromosomal rearrangements near the ST7 locus .

Comparative Genomic Analysis

ST7 exhibits high sequence homology across primates, underscoring its evolutionary conservation.

SpeciesHomology to Human ST7Source
Pan troglodytes~95% (ECD)
Chlorocebus aethiops~95%
Homo sapiens100% (reference)
Bos taurus98%

Production and Handling

Recombinant ST7 is optimized for stability and functional assays:

ParameterRecommendation
Reconstitution0.1–1.0 mg/mL in sterile water (with 5–50% glycerol)
Storage-20°C/-80°C; avoid freeze-thaw cycles
ApplicationsELISA, binding assays, structural studies

Research Challenges and Future Directions

While recombinant ST7 is widely used in bioassays, its precise biological role remains unclear. Ongoing studies focus on:

  • Deciphering its interactions with extracellular matrix remodeling factors (e.g., SPARC, MMPs) .

  • Investigating its role in primate-specific chromosomal evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
ST7
Target Protein Sequence
MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links

UniGene: Ptr.5354

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Suppressor of tumorigenicity 7 (ST7) protein in Pan troglodytes and how does it compare to human ST7?

Suppressor of tumorigenicity 7 (ST7) protein in Pan troglodytes (chimpanzee) is a protein encoded by the ST7 gene with a recommended name of "Suppressor of tumorigenicity 7 protein." This protein has been identified with UniProt accession number Q2QLE8 and encompasses 585 amino acids in its full-length form . The chimpanzee ST7 protein shares high sequence homology with human ST7, reflecting the close evolutionary relationship between these species.

The Pan troglodytes (chimpanzee) species from which this protein is derived is widely distributed across central Africa, from approximately 10 degrees N to 8 degrees S latitude, and from 15 degrees W to 32 degrees E longitude . This geographical context is important when considering the genetic diversity within ST7 variants.

The protein functions as a tumor suppressor, with its activity potentially involved in regulating cell proliferation and differentiation, though specific mechanisms may vary between human and chimpanzee variants due to species-specific evolutionary adaptations.

What are the structural characteristics of recombinant Pan troglodytes ST7 protein?

The recombinant Pan troglodytes ST7 protein has several notable structural characteristics:

  • Amino acid sequence: The full protein sequence is 585 amino acids, beginning with MAEAATGFLEQLKSCIVWSW and containing multiple transmembrane and functional domains .

  • Membrane topology: The protein contains hydrophobic regions indicative of transmembrane domains, as evidenced by segments such as "TYLWTVWFFIVLFLVYILRV" in the amino acid sequence .

  • Expression region: The recommended expression region for functional recombinant protein covers amino acids 1-585, representing the full-length protein .

  • Post-translational modifications: While specific modifications are not detailed in the available data, the protein likely undergoes similar post-translational processing as observed in other mammalian ST7 variants.

  • Structural domains: The sequence suggests several functional domains involved in protein-protein interactions and signaling pathways relevant to its tumor suppressor function.

Structural FeatureCharacteristicAmino Acid Position
Hydrophobic regionsTransmembrane domainsMultiple regions including 20-40
Protein-protein interaction motifsSignaling domainsDistributed throughout sequence
Expression regionFull-length protein1-585
Storage stability determinantsGlycerol-responsive regionsThroughout structure

What are the optimal storage and handling conditions for recombinant ST7 protein?

Optimal storage and handling of recombinant Pan troglodytes ST7 protein requires careful attention to buffer composition, temperature, and freeze-thaw cycles:

  • Storage buffer composition: The recommended buffer is Tris-based with 50% glycerol, specifically optimized for this protein's stability . The high glycerol content serves as a cryoprotectant to maintain protein structure during freezing.

  • Temperature conditions:

    • Long-term storage: -20°C or -80°C for extended preservation

    • Working aliquots: 4°C for up to one week

    • Shipping/handling: On ice or refrigerated (4°C)

  • Freeze-thaw management: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and activity loss. Researchers should prepare appropriate aliquots upon initial thawing .

  • Working concentration: The protein is typically supplied at a concentration compatible with most experimental applications, with 50 μg being a standard quantity (though other quantities are available) .

  • Handling precautions: Standard protein handling protocols apply, including use of low-binding tubes, avoidance of vortexing, and minimal exposure to room temperature.

What experimental designs are optimal for studying ST7 protein interactions in tumor suppression research?

When designing experiments to study Pan troglodytes ST7 protein interactions in tumor suppression research, several methodological approaches are recommended:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation (Co-IP) followed by mass spectrometry to identify novel binding partners

    • Yeast two-hybrid screening with the full-length ST7 or specific domains as bait

    • Proximity ligation assays in cellular contexts to confirm interactions in situ

    • FRET/BRET assays for real-time interaction dynamics in living cells

  • Functional domain mapping:

    • Site-directed mutagenesis of conserved residues followed by interaction assays

    • Truncation constructs to identify minimal binding domains

    • Domain swapping between Pan troglodytes and human ST7 to identify species-specific interaction differences

  • Pathway analysis:

    • Stable isotope labeling with amino acids in cell culture (SILAC) combined with phosphoproteomics to identify signaling changes induced by ST7

    • ChIP-seq to identify genomic binding sites if ST7 has nuclear functions

    • RNA-seq following ST7 overexpression or knockdown to identify transcriptional consequences

  • Cross-species comparative assays:

    • Parallel experiments with human and Pan troglodytes ST7 in both human and chimpanzee cell lines

    • Rescue experiments in ST7-knockout backgrounds from both species

These experimental designs should incorporate appropriate controls, including species-matched control proteins and careful validation of recombinant protein functionality.

How can contradictory findings in ST7 research be reconciled through methodological improvements?

Contradictory findings in ST7 research can be addressed through several methodological approaches that improve experimental design and data interpretation:

  • Standardization of recombinant protein preparation:

    • Consistent expression systems and purification protocols

    • Validation of protein folding and activity before experimentation

    • Detailed reporting of tag types and positions, which may be determined during the production process

  • Experimental design considerations:

    • Implementation of randomized response strategies to reduce bias in experimental design

    • Use of sufficient biological and technical replicates

    • Blind analysis protocols to minimize experimenter bias

  • Data analysis approaches:

    • Application of contradiction detection methods, such as those leveraging linguistic rules and large language models

    • Implementation of rigorous statistical frameworks that account for multiple hypothesis testing

    • Meta-analysis of published results with careful attention to experimental conditions

  • Reconciliation framework:

    • Systematic investigation of variables that differ between contradictory studies

    • Collaborative replication efforts between laboratories reporting different results

    • Development of consensus protocols through research community engagement

Source of ContradictionMethodological SolutionImplementation Strategy
Protein preparation varianceStandardized production protocolConsistent tag position and buffer composition
Cell line differencesCross-validation in multiple systemsParallel testing in normal and tumor-derived lines
Assay sensitivity limitationsMulti-method confirmationOrthogonal techniques for key findings
Species-specific effectsComparative human-chimpanzee designsSide-by-side testing of both ST7 variants

What are the most effective approaches for validating the biological activity of recombinant ST7 protein?

Validating the biological activity of recombinant Pan troglodytes ST7 protein requires a multi-faceted approach:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Size-exclusion chromatography to verify proper oligomeric state

    • Thermal shift assays to assess protein stability and proper folding

  • Functional assays:

    • Cell-based proliferation inhibition assays to confirm tumor suppression activity

    • Colony formation assays with ST7-transfected cancer cell lines

    • Migration and invasion assays to assess impact on metastatic potential

    • Gene expression analysis of known ST7-responsive genes

  • Interaction verification:

    • Surface plasmon resonance (SPR) or biolayer interferometry with known binding partners

    • Pull-down assays to confirm retention of interaction capabilities

    • Competitive binding assays against native ST7 protein

  • Comparative benchmarking:

    • Side-by-side testing with human ST7 for species-specific functional differences

    • Activity comparison with established lot numbers or reference standards

    • Cross-validation in multiple cell types, including Pan troglodytes-derived cells where available

  • Downstream signaling confirmation:

    • Phosphorylation status of known pathway components

    • Subcellular localization studies to confirm proper trafficking

    • Rescue experiments in ST7-null backgrounds

These validation approaches should be executed sequentially, beginning with structural confirmation and proceeding to more complex functional assays.

What considerations are important when designing expression systems for recombinant Pan troglodytes ST7 protein?

When designing expression systems for recombinant Pan troglodytes ST7 protein, researchers should consider several critical factors:

  • Expression host selection:

    • Mammalian expression systems (e.g., HEK293, CHO) for proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) as alternatives for higher yield with mammalian-like processing

    • Yeast systems for cost-effective scale-up, though with potential glycosylation differences

    • Bacterial systems only for non-glycosylated domains or with solubility enhancement strategies

  • Vector design considerations:

    • Codon optimization for the selected expression host

    • Signal peptide selection for secretion or membrane localization

    • Tag positioning (N- or C-terminal) to minimize interference with functional domains

    • Inclusion of protease cleavage sites for tag removal

    • Inducible promoters for controlled expression levels

  • Production optimization:

    • Temperature modulation during expression (often lowered to improve folding)

    • Media composition adjustments for optimal protein yield and quality

    • Harvest timing optimization to balance yield and degradation

    • Scale-up considerations for consistent protein quality

  • Purification strategy design:

    • Multi-step purification to ensure high purity

    • Buffer optimization during each purification step

    • Quality control checkpoints throughout the process

    • Activity retention verification at each stage

  • Special considerations for ST7:

    • The tag type will be determined during the production process to optimize for this specific protein

    • Strategies for membrane protein solubilization if transmembrane domains are included

    • Approaches for maintaining protein stability given the full-length expression region (1-585)

How can recombinant ST7 protein be applied in comparative oncology studies between humans and non-human primates?

Recombinant Pan troglodytes ST7 protein offers valuable opportunities for comparative oncology studies:

  • Cross-species functional analysis:

    • Side-by-side testing of human and chimpanzee ST7 in identical experimental systems

    • Chimeric protein construction to identify species-specific functional domains

    • Differential binding partner identification through comparative proteomics

    • Analysis of species-specific post-translational modifications

  • Evolutionary oncology approaches:

    • Comparison of ST7 sequence and function across primate lineages

    • Correlation of ST7 variations with species-specific cancer incidence rates

    • Investigation of selective pressures on ST7 genes across primates

    • Cancer cell line panels from multiple primate species treated with both human and Pan troglodytes ST7

  • Methodological framework:

    • Standardized assays applicable across species

    • Development of species-neutral antibodies or detection methods

    • Creation of reference datasets for cross-species comparison

    • Establishment of primary cell culture systems from multiple primates

  • Translational applications:

    • Identification of conserved ST7 domains as high-priority therapeutic targets

    • Development of ST7-based biomarkers applicable across primate species

    • Investigation of species-specific tumor suppressor mechanisms that could inform human cancer treatment

This comparative approach provides unique insights into the fundamental biology of tumor suppression while potentially identifying novel therapeutic strategies based on evolutionary conservation and divergence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.