Recombinant Pan troglodytes Taste receptor type 2 member 10 (TAS2R10)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant TAS2R10 is produced under optimized conditions for stability and functionality:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for long-term storage

Source:

Bitter Ligand Recognition

TAS2R10 detects structurally diverse bitter compounds, including strychnine, a toxic alkaloid. Activation triggers a signaling cascade:

  1. G-protein Activation: α-gustducin and β/γ subunits stimulate phospholipase C β2 (PLCβ2) .

  2. Calcium Release: Intracellular Ca²⁺ surges open potassium channels, depolarizing the cell membrane .

  3. Neural Signaling: ATP release via CALHM1/3 channels transmits taste signals to the brain .

Evolutionary Significance

  • TAS2R10 clusters near telomeres in primates, facilitating rapid gene duplication and adaptation .

  • Chimpanzee TAS2R10 shares orthology with human TAS2R loci but exhibits distinct ligand-binding profiles due to sequence divergence .

Table 1: Key Studies Involving Recombinant TAS2R10

Study FocusFindingsSource
Toxic Compound DetectionValidated strychnine binding via calcium flux assays in transfected cells.
Cancer ResearchOverexpression reduced neuroblastoma stemness markers (DLK1, CD133) and inhibited metastasis.
Structural AnalysisCryo-EM resolved ligand-binding pockets, aiding drug design for bitter blockers.

Industrial and Clinical Relevance:

  • Drug Development: Screens for bitter-masking agents in pharmaceuticals .

  • Diagnostic Tools: Commercial ELISA kits (e.g., Creative BioMart) quantify TAS2R10 in biological samples .

Comparative Genomics

Chimpanzee TAS2R10 shares 98% amino acid identity with human TAS2R10, yet copy number variations (CNVs) differ:

SpeciesTAS2R10 CopiesGenomic Cluster
Pan troglodytes2Chromosome 12p13
Homo sapiens1 (functional)Chromosome 12p13.2

Source:

Challenges and Future Directions

  • Thermostability: Lyophilization improves shelf life but may alter conformational dynamics .

  • Ligand Promiscuity: Broad specificity complicates agonist/antagonist design .

  • Cross-Species Studies: Functional comparisons with amphibian TAS2Rs (e.g., Xenopus tropicalis) could reveal evolutionary adaptations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R10; Taste receptor type 2 member 10; T2R10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MLRVVEGIFIFVVISESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI IITDGFIQIFSPNIYASSNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKMKNDTVWDLNMYKSEYFIKQILLNL GVIFFFTLSLITCVLLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMAIEISYFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK RKNLRVT
Uniprot No.

Target Background

Function

Function: A receptor potentially involved in bitterness perception and linked to gustducin. It may contribute to sensing the gastrointestinal tract's chemical composition. Activation of this receptor may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently lead to TRPM5 channel gating.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R10 and how does it function in Pan troglodytes?

TAS2R10 is a member of the taste receptor type 2 (TAS2R) family, which functions as a bitter taste receptor in chimpanzees. Like other TAS2Rs, it is a seven-transmembrane G protein-coupled receptor that detects bitter compounds and initiates signal transduction cascades . The receptor likely plays a role in the perception of bitterness by coupling with gustducin, activating phospholipase C-beta-2 (PLC-β2), and potentially gating transient receptor potential cation channel subfamily M member 5 (TRPM5), similar to the mechanism observed in human TAS2R family members .

In Pan troglodytes, TAS2R10 likely serves critical functions in food selection, helping chimpanzees avoid potentially toxic compounds that typically present with bitter tastes. The receptor may also have extraoral functions in other tissues, as has been demonstrated with other TAS2R family members.

How do Pan troglodytes TAS2R10 and human TAS2R10 compare structurally and functionally?

Pan troglodytes and human TAS2R10 share high sequence homology due to their close evolutionary relationship. Based on patterns observed with other TAS2R receptors, we can expect approximately 97-99% amino acid identity between chimpanzee and human TAS2R10, reflecting their recent divergence approximately 6-7 million years ago .

Functional differences may exist in ligand specificity and sensitivity, potentially reflecting dietary adaptations specific to each species. These differences would likely manifest as:

ParameterHuman TAS2R10Pan troglodytes TAS2R10
Sequence homologyReference~97-99% identity
Ligand binding affinityMay differ for specific compoundsMay show higher affinity for bitter compounds common in wild chimpanzee diet
Expression patternsFound in taste buds and extraoral tissuesSimilar distribution with potential differences in expression levels
Response dynamicsWell-characterized for several bitter compoundsLikely similar but may show species-specific response patterns

What is the genomic organization of TAS2R10 in Pan troglodytes?

The TAS2R10 gene in Pan troglodytes is likely organized similarly to other TAS2R family members. Based on the information about TAS2R genomic organization in vertebrates, we can infer that the TAS2R10 gene is probably:

  • Located within a cluster of other TAS2R genes, as approximately 82% of TAS2R genes across species are found in clusters .

  • Positioned relatively close to telomeric regions of the chromosome, as TAS2R genes generally tend to be located closer to chromosome ends in many species .

  • Characterized by a single coding exon structure without introns, which is typical of TAS2R genes.

The clustering of TAS2R genes facilitates rapid evolution through mechanisms like non-allelic homologous recombination, potentially allowing for adaptation to changing ecological conditions and dietary needs .

How should researchers design ligand screening assays for recombinant Pan troglodytes TAS2R10?

When designing ligand screening assays for recombinant Pan troglodytes TAS2R10, researchers should implement a comprehensive approach that includes:

  • Expression System Selection: Establish a heterologous expression system using HEK293 or similar mammalian cell lines that can effectively express the recombinant receptor. For proper membrane targeting, consider using a chimeric approach with the first 45 amino acids of rat somatostatin receptor type 3 to improve surface expression.

  • Functional Readout Selection: Implement calcium mobilization assays using fluorescent calcium indicators like Fluo-4 or calcium-sensitive bioluminescent proteins. For higher throughput, consider FLIPR (Fluorescent Imaging Plate Reader) technology.

  • Compound Library Design:

    • Begin with known human TAS2R10 ligands

    • Include natural bitter compounds from plants in chimpanzee habitats

    • Test structurally diverse bitter compounds to establish the receptor's chemical tuning

  • Assay Controls:

    • Positive control: Known TAS2R agonists that activate multiple bitter receptors

    • Negative control: Non-transfected cells or cells expressing a non-related GPCR

    • Species comparison control: Human TAS2R10 receptor in parallel assays

  • Dose-Response Analysis: Test active compounds across concentration ranges (typically 10⁻⁸ to 10⁻³ M) to determine EC₅₀ values and efficacy parameters.

This methodological approach mirrors successful strategies used for other TAS2R receptor characterization while addressing the specific needs for Pan troglodytes TAS2R10 research .

What evolutionary insights can be gained from comparative analysis of TAS2R10 across primate species?

Comparative analysis of TAS2R10 across primates offers valuable evolutionary insights:

This evolutionary approach provides context for understanding TAS2R10 function beyond simple receptor-ligand interactions.

What are the challenges in expressing functional recombinant TAS2R10 and how can they be overcome?

Expressing functional recombinant TAS2R10 presents several challenges:

  • Poor Membrane Trafficking: TAS2R receptors often show limited surface expression in heterologous systems.

    • Solution: Use chimeric constructs with the N-terminal region of successfully trafficking GPCRs like rhodopsin or the somatostatin receptor type 3. Adding specific export signals or removing retention signals can also improve surface expression.

  • Protein Instability: GPCRs may be unstable when extracted from their native membrane environment.

    • Solution: Introduce stabilizing mutations identified through directed evolution or computational prediction. Consider using stabilizing fusion partners like T4 lysozyme or BRIL in structural studies.

  • Post-translational Modification Requirements: Ensuring proper glycosylation and other modifications.

    • Solution: Select expression systems that perform mammalian-like post-translational modifications, such as HEK293 or CHO cells rather than bacterial or insect cell systems.

  • Coupling to Endogenous G Proteins: TAS2R10 may couple inefficiently to G proteins in heterologous systems.

    • Solution: Co-express gustducin or chimeric G proteins engineered to enhance coupling efficiency. Alternatively, use direct readout systems that measure receptor conformational changes rather than downstream signaling.

  • Functional Validation Challenges: Confirming that the recombinant receptor maintains native functionality.

    • Solution: Implement multiple orthogonal assays (calcium imaging, inositol phosphate accumulation, β-arrestin recruitment) to comprehensively characterize signaling capabilities.

Each of these challenges requires specific methodological approaches, similar to those used for other difficult-to-express GPCRs .

What protocols are recommended for purification of recombinant Pan troglodytes TAS2R10?

Purification of recombinant Pan troglodytes TAS2R10 requires a specialized protocol to maintain structural integrity and functionality:

  • Optimal Expression System:

    • Mammalian expression systems (HEK293 GnTI-) are preferred for proper folding and post-translational modifications

    • Use inducible expression systems to minimize toxicity

    • Consider adding C-terminal tags (10x His or 1D4) for purification while maintaining function

  • Solubilization Protocol:

    • Harvest cells 48-72 hours post-transfection

    • Lyse cells in buffer containing protease inhibitors

    • Solubilize membranes with gentle detergents:

      • Initial screening: DDM (n-Dodecyl-β-D-maltoside), LMNG (Lauryl maltose neopentyl glycol), or MNG-3

      • Optimize detergent concentration (typically 1-2% for solubilization, 0.01-0.05% for purification)

  • Purification Workflow:

    • Step 1: Affinity chromatography using Ni-NTA or 1D4 antibody columns

    • Step 2: Size exclusion chromatography to remove aggregates

    • Step 3: Optional ion exchange chromatography for further purification

  • Stabilization Strategies:

    • Add cholesteryl hemisuccinate (CHS) to all buffers (0.01-0.02%)

    • Include a known ligand during purification to enhance stability

    • Maintain glycerol (10%) in all buffers

  • Quality Control Assessments:

    • SDS-PAGE and Western blotting to confirm purity

    • Thermal stability assays to assess protein folding

    • Circular dichroism to verify secondary structure

    • Functional binding assays with known ligands

This protocol draws on established methodologies for GPCR purification while addressing the specific challenges of TAS2R family proteins .

How can researchers effectively measure signaling responses of recombinant TAS2R10 in vitro?

Researchers can effectively measure TAS2R10 signaling responses using the following methodologies:

  • Calcium Mobilization Assays:

    • Transfect cells with TAS2R10 and Gα16gust44 (a chimeric G-protein)

    • Load cells with calcium-sensitive dyes (Fluo-4 AM, Fura-2 AM)

    • Measure fluorescence changes upon ligand addition using:

      • Plate readers for high-throughput screening

      • Fluorescence microscopy for single-cell resolution

      • Flow cytometry for population analysis

  • Inositol Phosphate (IP) Accumulation Assays:

    • Label cells with [³H]myo-inositol

    • Measure IP accumulation after receptor activation

    • Advantages: quantitative, can detect weak activations

  • BRET/FRET-Based Assays:

    • Create fusion constructs with luminescent/fluorescent proteins

    • Measure energy transfer changes upon receptor activation

    • Enables real-time monitoring of protein-protein interactions

  • Electrophysiological Approaches:

    • Patch-clamp recordings from cells expressing TAS2R10 and appropriate channels

    • Measure conductance changes in response to bitter ligands

  • Label-Free Approaches:

    • Dynamic mass redistribution

    • Impedance-based cellular analysis

    • Advantages: no artificial tags, measures integrated cellular response

Assay TypeSensitivityThroughputTime ResolutionEquipment Requirements
Calcium imagingHighMedium-HighSecondsFluorescence plate reader
IP accumulationVery highLowMinutesScintillation counter
BRET/FRETMediumMediumMilliseconds-secondsLuminometer/Fluorometer
ElectrophysiologyVery highVery lowMillisecondsPatch-clamp setup
Label-freeMediumHighSeconds-minutesSpecialized readers

Each method offers distinct advantages, and researchers should select based on their specific experimental questions and available resources .

What techniques should be used to investigate TAS2R10 expression patterns in Pan troglodytes tissues?

To comprehensively investigate TAS2R10 expression patterns in Pan troglodytes tissues, researchers should employ multiple complementary techniques:

  • Quantitative RT-PCR (qRT-PCR):

    • Design primers specific to Pan troglodytes TAS2R10, avoiding cross-reactivity with other TAS2R family members

    • Use reference genes appropriate for each tissue type

    • Analyze relative expression across multiple tissues (tongue, palate, epiglottis, respiratory tract, gastrointestinal tissues, brain)

    • Methodology should include careful RNA extraction protocols optimized for each tissue type

  • RNA-Seq Analysis:

    • Perform transcriptome sequencing of multiple tissues

    • Apply bioinformatic workflows to identify TAS2R10 expression levels

    • Advantage: Allows discovery of novel splice variants or isoforms

  • In Situ Hybridization:

    • Use RNAscope or similar high-sensitivity methods to localize TAS2R10 mRNA in tissue sections

    • Combine with immunohistochemistry for cell-type markers to identify specific expressing cells

    • Critical for determining cellular distribution within heterogeneous tissues

  • Immunohistochemistry/Immunofluorescence:

    • Validate antibodies carefully for specificity against Pan troglodytes TAS2R10

    • Use multiple antibodies targeting different epitopes when possible

    • Include appropriate controls (peptide blocking, knockout references when available)

  • Single-Cell RNA-Seq:

    • Apply to dissociated taste buds and other relevant tissues

    • Creates comprehensive expression maps at single-cell resolution

    • Reveals co-expression patterns with other receptors and signaling components

As noted in studies of other TAS2R family members, extraoral expression of taste receptors is common and functionally significant, highlighting the importance of examining diverse tissue types beyond the oral cavity .

How should researchers analyze evolutionary conservation patterns of TAS2R10 across species?

To analyze evolutionary conservation patterns of TAS2R10 across species, researchers should implement a multi-layered approach:

  • Sequence Alignment and Phylogenetic Analysis:

    • Collect TAS2R10 sequences from diverse species, particularly focusing on primates

    • Perform multiple sequence alignment using MUSCLE, MAFFT, or similar algorithms

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Test different evolutionary models to find the best fit for TAS2R10 evolution

    • Calculate bootstrap values to assess confidence in tree topology

  • Selection Analysis:

    • Calculate site-specific dN/dS ratios using PAML, HyPhy, or similar programs

    • Identify potential positively selected sites (dN/dS > 1)

    • Apply likelihood ratio tests to compare models with and without positive selection

    • Conduct branch-site tests to identify lineage-specific selection events

  • Structural Mapping of Conservation:

    • Generate or obtain structural models of TAS2R10

    • Map conservation scores onto 3D structures

    • Identify conservation patterns in:

      • Ligand binding pocket

      • G-protein interaction interface

      • Transmembrane domains vs. loop regions

  • Functional Domain Analysis:

    • Compare conservation patterns across functional domains

    • Analyze whether extracellular loops (involved in ligand binding) show different conservation patterns than intracellular regions (involved in signaling)

  • Ecological Correlation Analysis:

    • Associate sequence variations with dietary specializations

    • Test for correlation between specific amino acid changes and ecological variables

    • Apply comparative methods that account for phylogenetic non-independence

This comprehensive approach draws on established methods used in studies of other TAS2R family members, which have revealed patterns of cluster organization and evolutionary dynamics .

What are the key considerations when comparing ligand binding profiles between human and Pan troglodytes TAS2R10?

When comparing ligand binding profiles between human and Pan troglodytes TAS2R10, researchers should consider:

  • Experimental Design Considerations:

    • Use identical expression systems for both receptors

    • Ensure equivalent surface expression levels through quantitative measures

    • Test compounds across wide concentration ranges (typically 10⁻⁸ to 10⁻³ M)

    • Include multiple biological and technical replicates

    • Perform experiments blinded to prevent experimenter bias

  • Pharmacological Parameter Analysis:

    • Compare not only EC₅₀ values but also:

      • Efficacy (maximum response)

      • Hill coefficients (indicating cooperativity)

      • Onset and offset kinetics

    • Use global curve fitting where appropriate

  • Statistical Approaches:

    • Apply appropriate statistical tests that account for multiple comparisons

    • Consider Bayesian approaches for comprehensive comparison of dose-response curves

    • Implement multivariate analysis for complex datasets

  • Structural Interpretation:

    • Correlate binding differences with sequence variations

    • Use molecular docking and molecular dynamics simulations to predict binding modes

    • Consider how specific amino acid differences might affect ligand interactions

  • Biological Context Integration:

    • Interpret differences in light of dietary adaptations

    • Consider how binding profile differences might affect food choice behavior

    • Evaluate potential consequences for toxin avoidance mechanisms

Analysis ParameterMethodological ApproachInterpretation Significance
Potency (EC₅₀)Nonlinear regression of dose-response curvesIndicates relative binding affinity
Efficacy (Eₘₐₓ)Normalized to positive control or maximum theoretical responseReflects receptor coupling efficiency
Response kineticsTime-resolved measurement of calcium flux or other signalsMay indicate differences in receptor-G protein coupling
Ligand selectivityScreening diverse chemical librariesReveals evolutionary adaptations to ecological factors

This framework ensures rigorous comparison while accounting for the biological and evolutionary context of taste receptor function .

How can researchers integrate structural biology approaches to understand TAS2R10 function?

Researchers can integrate multiple structural biology approaches to understand TAS2R10 function through the following methodological framework:

  • Homology Modeling and Molecular Dynamics:

    • Generate homology models based on related GPCRs with known structures

    • Refine models through extensive molecular dynamics simulations

    • Validate models through experimental mutation data

    • Use these models to:

      • Identify potential ligand binding pockets

      • Predict critical residues for receptor activation

      • Understand conformational changes during activation

  • Site-Directed Mutagenesis:

    • Design mutagenesis experiments based on structural predictions

    • Focus on:

      • Conserved motifs across TAS2Rs

      • Divergent residues between human and Pan troglodytes TAS2R10

      • Predicted ligand-binding pocket residues

    • Assess functional consequences through calcium imaging or other signaling assays

    • Create comprehensive mutation maps of structure-function relationships

  • Cryo-EM and X-ray Crystallography Preparation:

    • While no TAS2R structures have been determined to date, researchers can:

      • Design stabilized constructs for structural studies

      • Incorporate fusion proteins known to facilitate GPCR crystallization

      • Identify and optimize stabilizing ligands

      • Develop purification protocols that maintain structural integrity

  • Biophysical Characterization:

    • Apply techniques such as:

      • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

      • Circular dichroism to assess secondary structure

      • Thermal stability assays to identify stabilizing conditions

      • Fluorescence spectroscopy to monitor conformational changes

  • Integrative Structural Biology:

    • Combine multiple low-resolution structural data sources:

      • Cross-linking mass spectrometry

      • EPR spectroscopy

      • FRET-based distance measurements

    • Integrate with computational models for comprehensive structural understanding

This multi-faceted approach acknowledges the challenges in determining membrane protein structures while providing valuable insights into TAS2R10 function through complementary methodologies .

What emerging technologies might advance our understanding of TAS2R10 biology?

Several emerging technologies hold promise for advancing TAS2R10 research:

  • AlphaFold2 and Deep Learning Structural Prediction:

    • Apply AI-driven structural prediction specifically optimized for GPCRs

    • Generate high-confidence models of TAS2R10 without crystallographic data

    • Use predicted structures to guide experimental design and interpretation

  • CRISPR-Based Genetic Engineering:

    • Generate humanized TAS2R10 in model organisms

    • Create precise point mutations in cell lines to test structure-function hypotheses

    • Develop reporter systems with endogenous TAS2R10 locus tagging

  • Organoid Technology:

    • Develop taste bud organoids expressing TAS2R10

    • Study receptor function in a more physiologically relevant context

    • Investigate developmental regulation of TAS2R10 expression

  • Single-Cell Multi-Omics:

    • Combine transcriptomics, proteomics, and metabolomics at single-cell resolution

    • Map TAS2R10 expression to specific cell types across tissues

    • Understand cellular context influences on TAS2R10 signaling

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize TAS2R10 distribution in native tissues

    • Single-molecule tracking to monitor receptor dynamics in real-time

    • Correlative light and electron microscopy to relate receptor localization to ultrastructure

These technologies can overcome current limitations in taste receptor research, providing unprecedented insights into TAS2R10 biology at molecular, cellular, and organismal levels .

How might understanding TAS2R10 function contribute to comparative gustatory perception research?

Understanding TAS2R10 function can make significant contributions to comparative gustatory perception research:

  • Evolutionary Taste Adaptation Mechanisms:

    • Comparing human and Pan troglodytes TAS2R10 provides insights into how gustatory perception evolved during hominid divergence

    • Functional differences may reflect distinct selective pressures related to dietary specialization

    • Changes in receptor tuning could explain species-specific food preferences and aversions

  • Sensory Ecology Framework Development:

    • TAS2R10 research can help establish models connecting:

      • Genetic variations in taste receptors

      • Functional consequences for bitter compound detection

      • Behavioral outcomes in food selection

      • Ecological adaptations to available food resources

    • This framework can then be applied to other taste modalities and species

  • Neural Coding of Taste Information:

    • Understanding how TAS2R10 activation patterns translate to perceptual experiences

    • Comparing neural representations of bitter taste across species

    • Investigating how receptor-level differences manifest in central gustatory processing

  • Methodology Advancement:

    • Techniques developed for TAS2R10 characterization can be applied to other challenging taste receptors

    • Establishment of standardized comparative methods for cross-species taste receptor analysis

    • Development of in vitro systems that better recapitulate in vivo receptor function

This research direction connects molecular mechanisms to behavioral outcomes, providing valuable insights into the evolution of sensory systems across primates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.