Recombinant Pan troglodytes Taste receptor type 2 member 16 (TAS2R16)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pan troglodytes Taste Receptor Type 2 Member 16 (TAS2R16) is a genetically engineered protein derived from the chimpanzee (Pan troglodytes) bitter taste receptor TAS2R16. Produced in Escherichia coli (E. coli) with an N-terminal His-tag, this recombinant protein enables functional and structural studies of bitter taste perception mechanisms . TAS2R16 belongs to the G protein-coupled receptor (GPCR) family and plays a critical role in detecting β-glycosides, compounds associated with dietary preferences and toxin avoidance .

Expression System and Purification

ParameterSpecification
HostE. coli
TagN-terminal His-tag
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water + 5–50% glycerol
Storage-20°C/-80°C (avoid repeated freeze-thaw)
Source: Creative BioMart

Bitter Taste Signaling Pathway

TAS2R16 detects β-glucosides (e.g., salicin, amygdalin) and activates a signaling cascade involving:

  1. PLCβ2: Hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP₂).

  2. TRPM5: Mediates calcium influx, transmitting signals to the brain .

Ligand Binding and Specificity

  • Broad Reactivity: Accommodates diverse glycoside ligands via a hydrophobic pocket spanning TM3 and TM7 .

  • Ligand-Specific Mutations:

    LigandCritical ResiduesFunctional Effect
    SalicinTM3 (F93, I94), TM7 (W261)Loss of activity with W261A/G
    4-NP-β-glucosideTM7 (W261)Gain of activity with W261A

Functional Assays

  • Calcium Flux Assays: Measure receptor activation via intracellular Ca²⁺ release .

  • Surface Trafficking Studies: Quantify receptor expression using fluorescence/flow cytometry (e.g., N172K variant shows 48% trafficking efficiency) .

Evolutionary Insights

  • Conservation: β-glucoside sensitivity in TAS2R16 is ancestral to primates, with functional divergence observed in lemurs (e.g., arbutin acts as an inverse agonist in black lemurs) .

  • Adaptive Evolution: Positive selection at site 516 (N172K) correlates with heightened salicin sensitivity in humans .

Comparative Analysis Across Species

SpeciesTAS2R16 Sensitivity to β-GlucosidesKey Functional Notes
HumanHigh (EC₅₀: ~30 μM salicin)N172 allele enhances surface expression
ChimpanzeeComparable to humanRecombinant protein used for homolog studies
Macaque10-fold lower than humanReduced ligand affinity
Ring-tailed LemurConstitutive activityArbutin acts as agonist

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TAS2R16; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLEKFHQYQFQA HTVALVIPFILFLASTILLMASLTKQIQHHSTGHCNPSMKAHFTALRSLAVLFIVFTSYF LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of the gastrointestinal content. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.