Recombinant Pan troglodytes Taste receptor type 2 member 20 (TAS2R20)

Shipped with Ice Packs
In Stock

Description

Genetic Diversity and Subspecies-Specific Adaptations

  • Pseudogenization and Functional Divergence: Comparative studies of Pan troglodytes TAS2R20 with human (Homo sapiens) and bonobo (Pan paniscus) homologs reveal subspecies-specific haplotypes. For example, pseudogenes in humans (e.g., TAS2R62) are functional in chimpanzees, suggesting dietary adaptation .

  • C-Terminal Modifications: Differences in the C-terminal domains of TAS2R20 across primates may alter G-protein coupling efficiency, affecting signal transduction .

Key Genetic Variations in Chimpanzee TAS2Rs

Analysis of 59 chimpanzees identified significant variations in TAS2R20 and related genes :

Variation TypeFrequency in Pan troglodytesFunctional Impact
Nonsynonymous SNPs494 across TAS2R familyAltered ligand specificity
Indels40Frameshifts disrupting receptor function
Gene conversion events2Altered ligand-binding regions
Copy-number variationsObserved in 15% of eastern chimpsLoss/gain of functional genes

Evolutionary Biology

  • Dietary Adaptation: Subspecies-specific TAS2R20 variants in Pan troglodytes correlate with regional differences in bitter plant consumption, reflecting balancing selection pressures .

  • Population Genetics: Global diversity analyses show TAS2R20 has high nucleotide diversity (π = 0.36%) compared to other TAS2Rs, indicating relaxed purifying selection in humans .

Comparative Analysis with Other Primates

FeaturePan troglodytes TAS2R20Homo sapiens TAS2R20Pongo pygmaeus TAS2R20
Amino Acid Identity98% with humans Reference97% with humans
Pseudogene StatusFunctionalFunctionalFunctional
Key SNPsR127K, F189L P49A, V262M L83P, G214S

Technical Considerations for Experimental Use

  • Storage Stability: Avoid repeated freeze-thaw cycles; store at -80°C for long-term use .

  • Activity Assays: Functional validation requires reconstitution in lipid bilayers or cell membranes due to the receptor’s dependence on membrane topology .

  • Antibody Compatibility: Commercial antibodies (e.g., CSB-PA008614) show cross-reactivity with human and gorilla TAS2R20 but require validation for chimpanzee-specific epitopes .

Future Directions

  • Ligand Screening: High-throughput assays to identify bitter compounds activating chimpanzee TAS2R20.

  • Structural Biology: Cryo-EM studies to resolve ligand-bound vs. unbound states .

  • Ecological Correlations: Linking TAS2R20 variants to wild chimpanzee feeding behaviors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R20; TAS2R49; Taste receptor type 2 member 20; Taste receptor type 2 member 49; T2R49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLW VILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHH LKRKAKSVVLVIVLGSLFFLVCXLVMKNTYINVWTEECEGNVTWKIKLRNAMHLSNLTVA MLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI YFLCLITSFWNSKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCW AKGQNQSTP
Uniprot No.

Target Background

Function
This receptor, potentially involved in the perception of bitterness, is linked to gustducin. It may play a role in sensing the chemical composition of gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Pan troglodytes TAS2R20 and what is its primary function?

Pan troglodytes TAS2R20 is a G-protein-coupled taste 2 receptor expressed in taste buds that mediates bitter taste perception in chimpanzees. It belongs to the broader family of TAS2R genes that have evolved to detect potentially harmful bitter compounds in food sources. Like other bitter taste receptors, TAS2R20 plays a crucial role in food selection and avoidance behaviors, allowing chimpanzees to evaluate potentially toxic compounds before ingestion . The receptor functions by binding to specific bitter compounds, which triggers signaling cascades ultimately resulting in the sensation of bitterness.

How is TAS2R20 expression regulated in chimpanzee taste buds?

TAS2R20 expression in chimpanzee taste buds is regulated through complex transcriptional and post-transcriptional mechanisms. While the exact regulatory elements controlling TAS2R20 expression have not been fully characterized, studies of bitter taste receptor genes in mammals suggest that expression is controlled by taste cell-specific transcription factors. Research methodologies to investigate expression regulation include:

  • RNA-seq analysis of taste bud tissue

  • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

  • Reporter gene assays to validate promoter activity

  • In situ hybridization to localize expression in specific taste cell populations

The expression patterns may vary between different chimpanzee subspecies, potentially contributing to differences in taste sensitivity and dietary preferences across populations .

What genetic variations of TAS2R20 exist across different chimpanzee subspecies?

Significant genetic variation exists in TAS2R20 across chimpanzee subspecies. Comprehensive sequencing studies of 59 chimpanzees representing four putative subspecies (P. t. verus, P. t. ellioti, P. t. troglodytes, and P. t. schweinfurthii) have revealed multiple forms of genetic variation in TAS2R genes :

  • Single-nucleotide variations (SNVs)

  • Insertions and deletions (indels)

  • Gene-conversion variations

  • Copy-number variations (CNVs)

Approximately two-thirds of all TAS2R haplotypes in the amino acid sequence were found to be unique to each subspecies, indicating substantial genetic diversity . To properly characterize these variations, researchers employ whole-genome sequencing, targeted resequencing, and population genetic analyses to document the full spectrum of genetic diversity.

What haplotype patterns of TAS2R20 are observed within and between chimpanzee subspecies?

Haplotype analysis of TAS2R20 reveals complex patterns both within and between chimpanzee subspecies. Studies have shown that:

  • Distinct haplotype clusters often correspond to subspecies boundaries

  • Within subspecies, multiple haplotypes may be maintained through balancing selection

  • Between subspecies, divergent haplotypes reflect different evolutionary pressures

A comprehensive analysis of bitter taste receptor genes in chimpanzees revealed that approximately two-thirds of all cTAS2R haplotypes in the amino acid sequence were unique to each subspecies . This pattern suggests that local adaptation has shaped the evolution of bitter taste perception in chimpanzee populations.

To determine haplotype patterns, researchers typically:

  • Sequence TAS2R20 from multiple individuals across subspecies

  • Phase genetic variants into haplotypes

  • Calculate haplotype frequencies within populations

  • Construct haplotype networks to visualize relationships

  • Perform statistical tests to identify significant population structure

What is the optimal protocol for cloning and expressing recombinant Pan troglodytes TAS2R20?

The optimal protocol for cloning and expressing recombinant Pan troglodytes TAS2R20 involves several critical steps:

  • Gene synthesis or amplification:

    • Design primers based on the reference sequence with appropriate restriction sites

    • Amplify TAS2R20 from chimpanzee genomic DNA (as the gene lacks introns)

    • Alternatively, synthesize the gene based on published sequences

  • Cloning strategy:

    • Clone into a mammalian expression vector (e.g., pcDNA3.1)

    • Include an N-terminal tag (e.g., FLAG, Rho tag) to facilitate trafficking and detection

    • Consider adding a fluorescent protein tag (e.g., GFP) for visualization studies

  • Expression system:

    • Transiently transfect HEK293T cells (most common approach)

    • Co-transfect with Gα16gust44, a chimeric G protein to couple receptor activation to calcium signaling

    • Maintain cells in DMEM with 10% FBS for 24-48 hours post-transfection

  • Verification:

    • Confirm expression by Western blot using tag-specific antibodies

    • Verify membrane localization by immunofluorescence microscopy

    • Assess functionality using calcium mobilization assays with known bitter compounds

This methodology has been successfully applied in studies of panda TAS2R20 variants and can be adapted for chimpanzee receptor studies .

What cell-based assays are most effective for measuring TAS2R20 activation by bitter compounds?

The most effective cell-based assays for measuring TAS2R20 activation include:

  • Calcium mobilization assay:

    • Transfect cells with TAS2R20 and Gα16gust44

    • Load cells with calcium-sensitive dye (e.g., Fluo-4 AM)

    • Measure fluorescence changes upon compound addition using a fluorescence plate reader

    • Generate dose-response curves with varying ligand concentrations

  • Bioluminescence resonance energy transfer (BRET) assay:

    • Co-express TAS2R20 with tagged G-protein subunits

    • Measure energy transfer upon receptor activation

    • Provides real-time measurement of receptor-G protein interaction

  • Inositol phosphate (IP) accumulation assay:

    • Label cells with [³H]inositol

    • Measure IP generation following receptor activation

    • Offers quantitative measurement of downstream signaling

The calcium mobilization assay is most commonly used due to its sensitivity and ease of implementation . For comprehensive analysis, researchers should:

  • Include positive controls (known bitter compounds)

  • Include negative controls (non-bitter compounds)

  • Test multiple concentrations to generate EC50 values

  • Compare wild-type and variant receptors in parallel

How can we accurately measure the binding affinity of bitter compounds to TAS2R20 variants?

Accurately measuring the binding affinity of bitter compounds to TAS2R20 variants requires specialized techniques due to the challenges of working with GPCRs. The most reliable methods include:

  • Competitive binding assays:

    • Use radiolabeled or fluorescently labeled known ligands

    • Measure displacement by test compounds

    • Calculate IC50 and Ki values

  • Surface plasmon resonance (SPR):

    • Immobilize purified receptor on sensor chip

    • Measure real-time binding kinetics of compounds

    • Determine kon, koff, and KD values

  • Microscale thermophoresis (MST):

    • Label purified receptor with fluorescent dye

    • Measure changes in thermophoretic mobility upon ligand binding

    • Calculate binding affinities in solution

  • Functional dose-response assays as proxies:

    • Since direct binding assays can be challenging, EC50 values from functional assays

    • Generate full dose-response curves (10-12 to 10-3 M)

    • Fit data to determine potency (EC50) and efficacy (Emax)

For TAS2R20 variants, researchers should compare binding profiles across different subspecies to correlate genetic variations with functional differences. This approach has been successfully used for panda TAS2R20 variants, showing that specific amino acid substitutions (like A52V and Q296H) can significantly alter sensitivity to bitter compounds such as quercitrin .

What evolutionary pressures have shaped TAS2R20 diversity in Pan troglodytes?

The evolutionary pressures that have shaped TAS2R20 diversity in Pan troglodytes include:

  • Dietary adaptation:

    • Selection for variants that optimize detection of toxic compounds in local food sources

    • Balancing selection to maintain sensitivity to a diverse array of bitter compounds

    • Relaxed selection on receptors detecting compounds absent from the local environment

  • Subspecies-specific selection regimes:

    • Different forms of selection operate on TAS2R genes across subspecies

    • Western chimpanzees (P. t. verus) show evidence of balancing selection

    • Eastern chimpanzees (P. t. schweinfurthii) show evidence of purifying selection for certain TAS2R genes

  • Environmental factors:

    • Geographic variation in plant species composition

    • Differences in plant secondary metabolite profiles across habitats

To detect these evolutionary signatures, researchers calculate:

  • Tajima's D to identify departures from neutrality

  • FST to measure population differentiation

  • dN/dS ratios to detect positive or purifying selection

  • Haplotype diversity and linkage disequilibrium patterns

The diversity of TAS2R20 across chimpanzee populations reflects adaptation to local dietary conditions and ecological niches .

How does natural selection on TAS2R20 compare between chimpanzee subspecies?

Natural selection on TAS2R20 varies significantly between chimpanzee subspecies, reflecting different dietary adaptations and environmental challenges:

Chimpanzee SubspeciesSelection PatternPotential Dietary Correlation
Western (P. t. verus)Balancing selectionDiverse diet requiring sensitivity to multiple bitter compounds
Eastern (P. t. schweinfurthii)Purifying selectionSpecialized diet including specific bitter plants like Vernonia species
Central (P. t. troglodytes)Variable selectionMixed dietary pattern
Nigeria-Cameroon (P. t. ellioti)Insufficient dataRequires further investigation

These differences in selection patterns are detected through population genetic analyses such as:

  • Tajima's D calculations (positive values suggest balancing selection)

  • FST analysis to identify population differentiation

  • McDonald-Kreitman tests to compare polymorphism and divergence

  • Tests for selective sweeps and extended haplotype homozygosity

Research has shown that approximately two-thirds of all cTAS2R haplotypes are unique to each subspecies, suggesting strong local adaptation . These differences in selection regimes likely reflect subspecies-specific dietary repertoires and the different bitter compounds they encounter in their local environments.

What methods best detect signatures of natural selection on TAS2R20 in chimpanzee populations?

The most effective methods for detecting signatures of natural selection on TAS2R20 in chimpanzee populations include:

  • Site-frequency spectrum-based tests:

    • Tajima's D: Compares nucleotide diversity to number of segregating sites

    • Fu and Li's D and F: Examines distribution of mutations on genealogy

    • Fay and Wu's H: Detects high-frequency derived alleles

  • Population differentiation measures:

    • FST: Quantifies genetic differentiation between populations

    • PBS (Population Branch Statistic): Identifies branch-specific selection

  • Haplotype-based methods:

    • EHH (Extended Haplotype Homozygosity): Detects recent positive selection

    • iHS (integrated Haplotype Score): Identifies partial selective sweeps

    • XP-EHH: Compares haplotype lengths between populations

  • Comparative sequence analyses:

    • dN/dS ratio: Compares nonsynonymous to synonymous substitution rates

    • McDonald-Kreitman test: Compares polymorphism to divergence ratios

    • PAML analysis: Identifies specific codons under selection

For optimal results, researchers should implement a combination of these methods as demonstrated in studies of blind mole rats and giant pandas . For example, sliding window analysis with a window size of 20 kb and a step size of 5 kb can be used to calculate Tajima's D and FST values across the genome. Windows sharing the highest 5% of FST and lowest 5% Tajima's D estimates can be recognized as positively selected regions .

How do specific amino acid substitutions in TAS2R20 affect sensitivity to different bitter compounds?

Specific amino acid substitutions in TAS2R20 can dramatically alter receptor sensitivity to bitter compounds through several mechanisms:

  • Direct effects on ligand binding:

    • Substitutions in the binding pocket can enhance or reduce compound affinity

    • Changes in transmembrane domains can alter pocket architecture

    • Mutations in extracellular loops can affect ligand access

  • Effects on signal transduction:

    • Substitutions at G-protein coupling interfaces affect downstream signaling

    • Changes in intracellular loops may alter coupling efficiency

    • Modifications of key phosphorylation sites can impact receptor regulation

Research on TAS2R20 in giant pandas provides an instructive example: two nonsynonymous substitutions (A52V and Q296H) significantly decreased sensitivity to quercitrin . Similar structure-function relationships likely exist in chimpanzee TAS2R20 variants.

To systematically analyze these effects, researchers should:

  • Generate point mutations through site-directed mutagenesis

  • Express wild-type and mutant receptors in cell-based systems

  • Test responses to a panel of bitter compounds

  • Develop computational models to predict functional impacts of mutations

The results of such analyses can be presented as EC50 values (measure of potency) and Emax values (measure of efficacy) for each receptor variant and compound combination.

What is the ligand specificity profile of Pan troglodytes TAS2R20 compared to other TAS2R family members?

The ligand specificity profile of Pan troglodytes TAS2R20 differs from other TAS2R family members in several important ways:

  • Narrow vs. broad tuning:

    • Some TAS2R receptors (like TAS2R10, TAS2R14, and TAS2R46) are broadly tuned to numerous compounds

    • Others (potentially including TAS2R20) have more specific ligand profiles

    • TAS2R20 likely has intermediate specificity compared to broadly tuned receptors

  • Chemical class preferences:

    • Each TAS2R shows different affinities for chemical classes of bitter compounds

    • TAS2R20 may preferentially detect specific plant secondary metabolites

    • By comparison, TAS2R46 specifically responds to sesquiterpene lactones found in plants like Vernonia amygdalina

  • Comparison with homologs in other species:

    • Panda TAS2R20 specifically responds to quercitrin

    • Chimpanzee TAS2R20 likely responds to a different but potentially overlapping set of compounds

To characterize the ligand profile of TAS2R20, researchers should:

  • Screen the receptor against a diverse chemical library of bitter compounds

  • Compare activation profiles with other TAS2R family members

  • Determine structure-activity relationships for active compounds

  • Identify potential dietary sources of preferred ligands in chimpanzee habitats

The resulting data should be presented as a comprehensive activation matrix showing EC50 values for different receptor-ligand combinations.

How can we analyze the relationship between TAS2R20 variants and dietary plant compounds in chimpanzee habitats?

Analyzing the relationship between TAS2R20 variants and dietary plant compounds in chimpanzee habitats requires an integrated approach combining field studies, chemical analysis, and functional assays:

  • Field investigation:

    • Document plant species consumed and avoided by different chimpanzee populations

    • Collect samples of plants for chemical analysis

    • Record behavioral responses to bitter plants (e.g., processing techniques)

    • Note subspecies-specific dietary preferences

  • Chemical profiling:

    • Analyze plant samples using LC-MS/MS to identify bitter compounds

    • Quantify concentrations of bitter compounds in different plant parts

    • Create a chemical database of potential TAS2R20 ligands from the habitat

  • Functional screening:

    • Test plant extracts against recombinant TAS2R20 variants

    • Identify specific compounds responsible for receptor activation

    • Compare sensitivity of different subspecies' TAS2R20 variants

  • Correlation analysis:

    • Map genetic variants to geographical distribution of plant species

    • Correlate receptor sensitivity with plant compound abundance

    • Test hypotheses about coevolution of taste receptors and plant defenses

For example, researchers studying giant pandas found that pTAS2R20 variants with A52V and Q296H substitutions showed decreased sensitivity to quercitrin, which corresponded with higher quercitrin content in bamboo leaves consumed by pandas with these variants . Similar approaches could reveal how chimpanzee TAS2R20 variants are adapted to local plant chemistry.

How does Pan troglodytes TAS2R20 differ functionally from human TAS2R20?

Pan troglodytes TAS2R20 differs functionally from human TAS2R20 in several key aspects that reflect divergent evolutionary histories and dietary adaptations:

  • Sequence divergence:

    • Approximately 98-99% sequence identity at the amino acid level

    • Critical differences in ligand-binding domains

    • Potential differences in N-glycosylation sites affecting receptor trafficking

  • Ligand sensitivity profiles:

    • Different EC50 values for the same bitter compounds

    • Potentially different ranges of detected compounds

    • Species-specific agonists and antagonists

  • Signal transduction efficiency:

    • Potentially different coupling efficiency to G-proteins

    • Varied levels of receptor desensitization and internalization

    • Different downstream signaling cascade activation

To systematically characterize these differences, researchers should:

  • Express both receptors in identical cell systems

  • Compare response profiles to a standardized bitter compound library

  • Analyze chimeric receptors to identify domains responsible for functional differences

  • Correlate functional differences with dietary disparities between humans and chimpanzees

These studies would provide insight into how bitter taste reception has evolved in response to different dietary pressures in humans and chimpanzees since their evolutionary divergence.

What can comparative studies of TAS2R20 across primates tell us about bitter taste evolution?

Comparative studies of TAS2R20 across primates can reveal important insights about bitter taste evolution:

  • Evolutionary rate and selective pressure:

    • TAS2R genes generally evolve more rapidly than many other gene families

    • Different primate lineages show varying rates of TAS2R20 evolution

    • Patterns of positive, purifying, or balancing selection differ across species

  • Correlation with dietary specialization:

    • Folivorous primates may show different patterns than frugivorous species

    • Species with more diverse diets might maintain more TAS2R variability

    • Specialized feeders may show evidence of relaxed selection on certain receptors

  • Molecular convergence:

    • Unrelated primate species with similar diets may show convergent amino acid changes

    • Similar functional adaptations can arise from different genetic changes

    • Parallel evolution can occur in response to similar bitter compounds

To conduct effective comparative studies, researchers should:

  • Sequence TAS2R20 from diverse primate species

  • Reconstruct the evolutionary history using phylogenetic methods

  • Express ancestral and extant receptors to test functional evolution

  • Correlate receptor function with known dietary ecology

Such studies could reveal, for example, whether the directional selection observed in Qinling panda TAS2R20 has parallels in certain primate lineages with specialized diets.

How can we apply findings from Pan troglodytes TAS2R20 research to conservation biology?

Findings from Pan troglodytes TAS2R20 research can be applied to conservation biology through several approaches:

  • Habitat protection prioritization:

    • Identify plant species critical for chimpanzee nutrition through TAS2R20-plant compound analyses

    • Prioritize protection of areas with plant species matched to local chimpanzee TAS2R profiles

    • Preserve genetic diversity of chimpanzee populations with unique TAS2R adaptations

  • Population management strategies:

    • Use TAS2R20 variation as a marker for genetic diversity

    • Consider taste receptor adaptations when planning reintroductions

    • Avoid mixing populations with different taste adaptations unless necessary

  • Dietary support during rehabilitation:

    • Tailor rehabilitation diets to match subspecies-specific taste sensitivities

    • Recognize that food preferences may have genetic basis in taste receptor variants

    • Provide appropriate bitter plants that match ancestral dietary adaptations

  • Monitoring climate change impacts:

    • Track changes in plant community composition relative to chimpanzee taste adaptations

    • Predict potential dietary challenges as habitats change

    • Identify populations potentially at risk due to mismatch between taste receptors and available plants

Implementation requires:

  • Creating databases linking TAS2R20 variants to geographical distributions

  • Mapping plant chemical profiles across chimpanzee habitats

  • Developing non-invasive methods to genotype TAS2R genes in wild populations

  • Integrating taste receptor data with broader conservation planning

For example, if eastern chimpanzees have specific adaptations allowing them to consume medicinal plants like Vernonia amygdalina , conserving these plant species within their habitat would be crucial for population health.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.