Recombinant Pan troglodytes Taste receptor type 2 member 30 (TAS2R30)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

TAS2R30 is encoded by the TAS2R30 gene (alternative names: T2R47, TAS2R47) and expressed in recombinant form for experimental studies. Key features include:

PropertyDetail
Host SystemsProduced in E. coli, yeast, baculovirus, or mammalian cell systems .
Purity≥85% as confirmed by SDS-PAGE .
StructureSeven transmembrane domains typical of GPCRs, with extracellular loops involved in ligand binding .
Sequence LengthPartial sequences (~300–310 amino acids) are commonly expressed .

Structural studies reveal conserved residues in transmembrane domains critical for signal transduction . For example, positions in TM3 (e.g., Phe-80) and ECL2 (e.g., Glu-150) are implicated in ligand interaction .

Bitter Ligand Specificity

TAS2R30 detects bitter compounds such as amarogentin, a secoiridoid glycoside. Functional assays demonstrate:

  • High sensitivity: Activation thresholds as low as 1.0×1081.0 \times 10^{-8} M for amarogentin .

  • Genetic variants: Two common haplotypes (TAS2R30-H1 and -H2) show divergent responses:

    • H1: EC50_{50} = 4.1×1074.1 \times 10^{-7} M, maximum amplitude = 0.50 ΔF/F .

    • H2: Reduced efficacy (maximum amplitude = 0.12 ΔF/F) .

Ligand-Receptor Interactions

TAS2R30 is classified among "broadly tuned" receptors, responding to multiple agonists. A chemoinformatic analysis highlights its interaction with diverse scaffolds:

ReceptorNumber of AgonistsMedian Molecular Weight
TAS2R304477 Da

Bitter Taste Signaling

TAS2R30 couples with gustducin (Gα subunit) to activate PLCβ2 and TRPM5 channels, facilitating calcium signaling in taste cells . Key findings include:

  • Role in gastrointestinal chemosensing, influencing nutrient absorption and toxin avoidance .

  • Genetic polymorphisms linked to interindividual differences in bitter perception .

Assay Development

Bioluminescence-based calcium assays have been optimized for TAS2Rs, enhancing sensitivity for ligands like amarogentin . Modifications to TAS2R30’s N-terminal signal sequences improved plasma membrane localization, increasing assay reliability .

Evolutionary and Genomic Context

  • Gene Location: Chromosome 12p13.2 in humans, with a single exon structure .

  • Primate Specificity: Expressed in Pan troglodytes (chimpanzee) and Pan paniscus (bonobo), with sequence divergence influencing ligand specificity .

  • Regulatory Elements: Promoter regions enriched for transcription factors like ETS1 and STAT3, suggesting complex regulatory mechanisms .

Clinical and Therapeutic Relevance

While primarily studied in taste perception, extraoral TAS2R30 expression has been noted in cardiac tissues, hinting at roles in cardiovascular signaling . Its involvement in detecting plant-derived toxins positions it as a target for:

  • Bitterness-masking agents in pharmaceuticals.

  • Nutritional interventions targeting gut-brain axis communication .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R30; TAS2R47; Taste receptor type 2 member 30; Taste receptor type 2 member 47; T2R47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLW VLLLHWYATQLNPAFYSVEVRITVYNVWAVTNHFSSWLATSLSMFYLLKIANFSNLIFLR IKRRVKSVVLVILLGPLLFLVCHLFVINMDETIWTKEYEGNMTWKIKLRSAMYHSNMTLT MLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAI YFLSMIISVCNLGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLWHVRYW VKDRSLRLHRFTRAALCKG
Uniprot No.

Target Background

Function
This receptor is thought to play a role in the perception of bitterness and is linked to gustducin. It may also be involved in sensing the chemical composition of the gastrointestinal content. Activation of this receptor potentially stimulates alpha gustducin, mediates PLC-beta-2 activation, and leads to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R30 and what is its functional role in Pan troglodytes?

TAS2R30 is a bitter taste receptor gene belonging to the broader TAS2R family. In chimpanzees (Pan troglodytes), this receptor enables bitter taste perception by detecting specific chemical compounds. Like other bitter taste receptors, TAS2R30 is predicted to be located in the plasma membrane where it functions in chemical stimulus detection . The receptor belongs to a class of G protein-coupled receptors that trigger intracellular signaling cascades when activated by bitter compounds. Beyond oral taste perception, emerging research suggests TAS2R receptors may also mediate responses to compounds entering airways, gut, and other tissues, indicating potential broader physiological functions than previously recognized .

How does Pan troglodytes TAS2R30 compare structurally to its human ortholog?

The human TAS2R30 gene is located on chromosome 12p13.2 (12:11132958-11134644) and consists of a single exon . Similarly, the chimpanzee ortholog maintains this single-exon structure, which is characteristic of most TAS2R genes. Functionally, both are involved in bitter taste perception, though sequence variations between human and chimpanzee TAS2R30 may affect ligand specificity and receptor binding properties. In the human genome nomenclature system, TAS2R30 has also been referenced as T2R30, T2R47, and TAS2R47, indicating some historical variation in the literature . Both are members of the "human cluster" of TAS2Rs that appears to have undergone recent gene duplications in the primate lineage .

What genetic variations of TAS2R30 have been identified across chimpanzee subspecies?

Several important genetic variations have been documented in Pan troglodytes TAS2R30, with notable subspecies differences:

MutationFunctional EffectWestern ChimpanzeesEastern ChimpanzeesCentral ChimpanzeesNigerian-Cameroonian
19 bp insertionNon-functional3/92 (3%)0/20 (0%)0/4 (0%)0/2 (0%)

The 19 bp insertion mutation rendering TAS2R30 non-functional appears exclusively in western chimpanzees (P. t. verus) at a low frequency of 3%, while being completely absent in the other subspecies . This subspecies-specific variation likely reflects dietary adaptations particular to western chimpanzee habitats, consistent with the broader pattern where approximately two-thirds of all TAS2R protein haplotypes across the receptor family are unique to particular subspecies .

What methods are typically used to express recombinant Pan troglodytes TAS2R30 for functional studies?

For functional characterization of recombinant Pan troglodytes TAS2R30, researchers typically employ a systematic approach:

  • Gene cloning: Amplifying the TAS2R30 coding sequence from chimpanzee genomic DNA using specific primers designed to capture the complete coding region.

  • Expression vector construction: Inserting the amplified sequence into a mammalian expression vector, often incorporating epitope tags (e.g., FLAG, Myc) for detection purposes.

  • Cell transfection: Introducing the expression construct into appropriate mammalian cell lines (commonly HEK293T cells) that lack endogenous bitter taste receptors.

  • Expression verification: Confirming proper protein expression and membrane localization through techniques such as Western blotting, immunofluorescence microscopy, or flow cytometry.

  • Functional assays: Conducting calcium mobilization assays to measure receptor activation in response to various bitter compounds, typically using fluorescent calcium indicators or FRET-based approaches.

Commercial sources provide recombinant Pongo pygmaeus (orangutan) TAS2R30 for comparative studies , suggesting similar methodologies could be applied for Pan troglodytes TAS2R30.

How do evolutionary selection pressures differ for TAS2R genes among chimpanzee subspecies?

The evolutionary pressures acting on TAS2R genes, including TAS2R30, vary significantly across chimpanzee subspecies, reflecting different adaptive strategies:

  • Western chimpanzees (P. t. verus): Evidence suggests that TAS2R gene diversification resulted primarily from balancing selection, which maintains multiple alleles within a population. This pattern indicates potential advantages to having diverse bitter taste perception abilities within the population .

  • Eastern chimpanzees (P. t. schweinfurthii): In contrast, purifying selection (negative selection) dominates the evolutionary pattern for the "human cluster" of TAS2Rs, suggesting evolutionary pressure to maintain specific receptor functions and eliminate deleterious mutations .

  • Other subspecies and receptor subgroups: Many TAS2Rs show no obvious selection signals as a whole, suggesting neutral evolution or more complex selection patterns .

These differential selection patterns are detected through several computational methods:

  • FST statistics to measure population differentiation

  • Comparison of nucleotide diversity (π) within populations

  • Analysis of nonsynonymous to synonymous substitution ratios

  • Tests for selective sweeps and balancing selection

Specific TAS2R SNVs showing high FST values (>0.6) between western and eastern chimpanzees include Gln72Arg of TAS2R41 (FST = 1), Arg310His of TAS2R60 (FST = 0.818), and a loss-of-start SNV of TAS2R38 (FST = 0.614) , indicating significant population differentiation in these bitter taste receptors.

What methodological challenges exist in characterizing subspecies-specific TAS2R30 variants?

Several methodological challenges complicate the study of subspecies-specific TAS2R30 variants:

To address these challenges, researchers must employ strategies such as codon optimization for better expression, chimeric receptor approaches to study specific domains, and interdisciplinary collaboration between geneticists, biochemists, and field primatologists.

How can researchers distinguish between functional consequences of TAS2R30 variations and compensatory mechanisms in taste perception?

Distinguishing direct functional consequences of TAS2R30 variations from compensatory effects requires a multi-level research approach:

  • In vitro functional characterization:

    • Express each TAS2R30 variant individually in heterologous systems

    • Generate comprehensive dose-response curves for various bitter ligands

    • Quantify differences in receptor sensitivity (EC50 values) and efficacy (maximum response)

    • Determine if non-functional variants (e.g., those with the 19 bp insertion) show complete or partial loss of function

  • Receptor interaction studies:

    • Co-express TAS2R30 variants with other bitter taste receptors to detect potential interactions

    • Investigate whether non-functional TAS2R30 variants affect the function of other co-expressed receptors

    • Examine if other receptors show upregulation in the presence of non-functional TAS2R30

  • Systems-level analysis:

    • Compare the complete bitter receptor repertoire across subspecies

    • Identify patterns of co-evolution between receptors

    • Assess whether loss-of-function in one receptor correlates with gain-of-function in others

  • Behavioral validation:

    • Develop ethically appropriate behavioral assays to test bitter compound perception

    • Compare behavioral responses to specific compounds with genetic profiles

    • Use statistical methods to isolate the contribution of TAS2R30 variants from other factors

This comprehensive approach helps determine whether altered TAS2R30 function directly impacts bitter perception or if compensatory mechanisms through other receptors maintain perceptual homeostasis.

What is the relationship between TAS2R30 variations and dietary adaptations in different chimpanzee populations?

The relationship between TAS2R30 variations and dietary adaptations represents a key aspect of chimpanzee evolutionary ecology:

  • Subspecies-specific genetic profiles:
    Approximately two-thirds of all TAS2R haplotypes are unique to specific chimpanzee subspecies, indicating strong genetic differentiation in bitter taste perception genes . This pattern aligns with observed differences in dietary repertoires from East to West across tropical Africa.

  • Functional implications of specific variants:
    The 19 bp insertion in TAS2R30 found exclusively in western chimpanzees renders the receptor non-functional . This suggests potential adaptation to specific dietary components in western chimpanzee habitats that might contain compounds normally detected by functional TAS2R30.

  • Selection pattern differences:
    The contrasting evolutionary pressures observed (balancing selection in western chimpanzees versus purifying selection in eastern chimpanzees) suggest different dietary adaptation strategies . Balancing selection may maintain diverse alleles to handle variable food sources, while purifying selection may conserve critical receptor functions for detecting specific toxic compounds.

  • Methodological approach to establish dietary connections:

    • Characterize the bitter compound profiles of plants consumed by different chimpanzee populations

    • Test TAS2R30 variants against these specific compounds in functional assays

    • Analyze feeding ecology data to identify subspecies-specific food preferences

    • Correlate genetic variations with specific dietary components

This integrative approach can help determine whether TAS2R30 variations represent specific adaptations to local plant chemistry and available food resources in different chimpanzee habitats.

What are optimal experimental designs for comparative analysis of Pan troglodytes TAS2R30 across subspecies?

An optimal experimental design for comprehensive comparative analysis of TAS2R30 across chimpanzee subspecies would include:

  • Sample collection strategy:

    • Obtain DNA samples from all four recognized subspecies: western (P. t. verus), eastern (P. t. schweinfurthii), central (P. t. troglodytes), and Nigerian-Cameroonian (P. t. ellioti)

    • Target minimum sample sizes of 20-30 individuals per subspecies for robust statistical analysis

    • Include samples from multiple geographical locations within each subspecies' range to capture intra-subspecies diversity

  • Genetic characterization approach:

    • Sequence the complete coding region of TAS2R30 from all samples

    • Identify all genetic variants (SNVs, indels, structural variations)

    • Use computational methods to predict functional effects of amino acid substitutions

    • Conduct haplotype analysis to understand evolutionary relationships between variants

  • Functional assessment protocol:

    • Clone representative haplotypes from each subspecies into expression vectors

    • Express receptors in HEK293T cells with Gα16gust44 to couple receptor activation to calcium signaling

    • Perform calcium mobilization assays using a diverse panel of bitter compounds

    • Include compounds from plants present in chimpanzee diets across different habitats

    • Generate complete dose-response curves to determine EC50 and maximum response values

  • Integrative analysis:

    • Correlate genetic variations with functional differences in receptor activation

    • Map functional variations to the three-dimensional receptor structure

    • Relate findings to ecological and dietary information from field studies

    • Apply population genetics analyses to detect signatures of selection

This comprehensive approach allows for robust comparison of TAS2R30 function across subspecies while providing insights into the evolutionary and ecological significance of observed variations.

Overview of TAS2R genetic variation patterns across chimpanzee subspecies

Comprehensive genetic analysis of TAS2R genes in chimpanzees has revealed remarkable diversity patterns:

These patterns of genetic diversity indicate substantial differentiation in bitter taste perception capabilities across chimpanzee subspecies, likely reflecting adaptation to different dietary environments.

Specific variations affecting TAS2R30 function

Several types of variations affecting TAS2R30 and other TAS2R genes have been documented:

  • TAS2R30-specific variation:

    • A 19 bp insertion causing loss of function, found exclusively in western chimpanzees at 3% frequency (3/92 alleles)

  • Other functionally significant TAS2R variations observed across the receptor family:

    • Loss of start codons (e.g., in TAS2R3, TAS2R38, TAS2R43, TAS2R45)

    • Gain of stop codons (e.g., in TAS2R7, TAS2R31, TAS2R40, TAS2R46)

    • Small indels causing frameshift mutations (e.g., 1 bp deletion in TAS2R1, 5 bp deletion in TAS2R42)

    • Whole-gene deletions (affecting TAS2R43, TAS2R46, and TAS2R64 in eastern chimpanzees)

  • Copy number variations:

    • Eastern chimpanzees exhibit CNVs in TAS2R43, TAS2R46, and TAS2R64

    • A large deletion variant spanning 67,330 bp results in whole-gene deletions of these receptors

    • This deletion variant was found as a homozygote in one eastern chimpanzee and as a heterozygote in another

These variations demonstrate the complex genetic landscape of bitter taste receptors in chimpanzees and highlight how different types of mutations can affect receptor function.

Evolutionary selection patterns influencing TAS2R genes

Analysis of evolutionary selection patterns reveals different selective pressures acting on TAS2R genes across chimpanzee subspecies:

  • Western chimpanzees (P. t. verus):

    • Diversification of TAS2Rs appears to result from balancing selection

    • This suggests evolutionary advantage in maintaining multiple alleles within the population

  • Eastern chimpanzees (P. t. schweinfurthii):

    • Purifying selection predominates for the "human cluster" of TAS2Rs

    • This indicates evolutionary pressure to conserve specific receptor functions

  • Population differentiation:

    • Specific SNVs show high FST values, indicating significant differentiation between subspecies

    • Examples include Gln72Arg of TAS2R41 (FST = 1), Arg310His of TAS2R60 (FST = 0.818), and a loss-of-start SNV of TAS2R38 (FST = 0.614)

  • Classification-specific patterns:

    • TAS2Rs are classified into two groups: the "human cluster" (resulting from recent gene duplications) and phylogenetically older TAS2Rs

    • These groups appear to be under different selective constraints

These different evolutionary patterns suggest that dietary adaptations and selective pressures on bitter taste perception vary significantly across the geographic range of chimpanzees, potentially reflecting differences in the plant species and toxic compounds encountered in their respective habitats.

Significance of TAS2R30 research for primate evolutionary studies

Research on TAS2R30 and other bitter taste receptors offers valuable insights into primate evolution:

  • Sensory adaptations and speciation:
    The marked diversification of TAS2R genes at the subspecies level in chimpanzees provides a valuable model for understanding how sensory perception may contribute to population differentiation and potentially speciation processes. With approximately two-thirds of protein haplotypes being unique to specific subspecies, taste receptor genetics may reflect early stages of adaptive divergence .

  • Comparative genomics perspective:
    Studying TAS2R30 across great apes (including the available orangutan data ) creates opportunities for comparative genomic studies that can illuminate the evolutionary history of taste perception in the primate lineage. This comparative approach helps distinguish between ancestral traits and derived adaptations.

  • Natural selection patterns:
    The different patterns of selection observed across chimpanzee subspecies (balancing selection in western chimpanzees vs. purifying selection in eastern chimpanzees) provide a natural experiment for understanding how evolutionary forces shape sensory perception genes . These patterns reflect the complex interplay between ecological pressures and genetic adaptation.

  • Molecular evolution mechanisms:
    The complex pattern of SNVs, indels, gene conversions, and CNVs observed in TAS2R genes demonstrates multiple molecular mechanisms driving bitter taste receptor evolution . This diversity of evolutionary mechanisms contributes to our understanding of how functional genetic diversity arises and is maintained.

  • Linking genetics to ecology:
    TAS2R30 research bridges the gap between molecular genetics and ecological adaptation, providing concrete examples of how genetic variations may influence dietary choices and adaptation to local environments through changes in sensory perception.

Future research directions and methodological approaches

Several promising research directions could advance our understanding of TAS2R30 in chimpanzee evolution:

  • Comprehensive functional characterization:

    • Systematically test all identified TAS2R30 variants against a diverse panel of bitter compounds

    • Develop high-throughput screening methods to identify novel ligands for chimpanzee TAS2R30

    • Investigate potential interactions between TAS2R30 and other bitter taste receptors

  • Ecological correlations:

    • Conduct detailed phytochemical analysis of plants consumed by different chimpanzee subspecies

    • Test whether subspecies-specific TAS2R30 variants show differential sensitivity to compounds in their local diet

    • Analyze feeding behavior in relation to plants containing compounds detected by TAS2R30

  • Expanded population sampling:

    • Increase sample sizes for Nigerian-Cameroonian and central chimpanzees, which are currently underrepresented

    • Include samples from across the geographic range of each subspecies to capture intra-subspecies variation

    • Develop non-invasive sampling methods to study wild populations

  • Technological innovations:

    • Apply CRISPR-based approaches to create cellular models with subspecies-specific TAS2R profiles

    • Develop organoid systems to study taste perception in a more physiologically relevant context

    • Use advanced structural biology techniques to understand how specific variations affect receptor function

  • Broader physiological roles:

    • Investigate potential extraoral functions of TAS2R30 in tissues such as airways and digestive tract

    • Explore whether subspecies-specific variations affect these non-taste functions

    • Examine potential interactions between taste perception and gut microbiome composition

These research directions would significantly advance our understanding of how TAS2R30 variations contribute to dietary adaptation and evolutionary divergence in our closest living relatives, with potential implications for human evolution and sensory biology.

Quality control measures for recombinant TAS2R30 expression studies

Ensuring reliable results in recombinant TAS2R30 expression studies requires rigorous quality control measures:

  • Expression verification protocols:

    • Confirm protein expression through multiple methods (Western blot, immunofluorescence, flow cytometry)

    • Verify correct membrane localization using confocal microscopy

    • Assess glycosylation status to confirm proper post-translational processing

    • Include positive controls with known functional bitter taste receptors

  • Functional assay standardization:

    • Establish stable reference compounds with well-characterized dose-response profiles

    • Include internal standards to normalize responses across experimental batches

    • Perform assays in triplicate with appropriate statistical analysis

    • Verify that responses are receptor-mediated using antagonists or receptor-negative controls

  • Construct design considerations:

    • Incorporate epitope tags that minimally impact receptor function

    • Consider codon optimization for improved expression in heterologous systems

    • Include appropriate leader sequences to enhance membrane trafficking

    • Design constructs to allow for detection of both N- and C-terminal processing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.