Recombinant Pan troglodytes Taste receptor type 2 member 38 (TAS2R38)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pan troglodytes Taste Receptor Type 2 Member 38 (TAS2R38) is a genetically engineered form of the bitter taste receptor protein derived from chimpanzees (Pan troglodytes). This receptor, a G protein-coupled receptor (GPCR), is responsible for detecting bitter compounds such as phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) . Recombinant production enables large-scale synthesis for functional and structural studies, bypassing challenges associated with native protein extraction .

Production and Purification

Recombinant TAS2R38 is synthesized using heterologous expression systems. Common platforms include:

Host SystemPurityYieldApplication
Cell-free expression≥85%0.02–0.1 mgStructural studies, ligand screening
Mammalian cells≥85%0.1–5 mgFunctional assays (e.g., calcium imaging)
E. coli≥85%VariableCost-effective bulk production

Tags such as His or FLAG are often added for purification and detection .

Ligand Specificity

Chimpanzee TAS2R38 responds to PTC but exhibits reduced sensitivity compared to human variants due to a start codon mutation (ATG>AGG) . Functional rescue experiments restoring the start codon recover PTC detection (EC₅₀: 1.35–5.59 µM) .

Calcium Imaging Assays

Recombinant TAS2R38 transfected into HEK293 cells showed:

  • Wild-type (WT): Strong calcium flux upon PTC exposure .

  • Mutant (MfTAS2R38-K): No response due to truncated protein (96-aa deletion) .

  • Engineered Rescue (RC-K): Restored function with upstream start codon .

Comparative Insights Across Primates

SpeciesKey MutationPhenotypeLigand Sensitivity
Human (Homo sapiens)A49P, A262V, V296ITaster (PAV) vs. Non-taster (AVI)High (PAV) / Low (AVI)
Chimpanzee (Pan troglodytes)Start codon (ATG>AGG)Non-tasterNone (unless rescued)
Japanese macaqueStart codon (ATG>ACG)Non-tasterNone

Applications in Research

  1. Ligand-Receptor Interaction Mapping: Identifies residues critical for bitter compound binding .

  2. Evolutionary Studies: Clarifies selection pressures on bitter taste perception in primates .

  3. Disease Modeling: Links TAS2R38 dysfunction to immune responses (e.g., chronic rhinosinusitis) .

Challenges and Future Directions

  • Structural Resolution: No full-length crystal structures exist; cryo-EM studies are ongoing .

  • Ligand Diversity: Only 23 ligands (e.g., PTC, PROP) are confirmed for TAS2R38 .

  • Interspecies Variability: Functional differences between primate orthologs remain underexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TAS2R38; Taste receptor type 2 member 38; T2R38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MLTLTRIHTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQPLSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAVLISG NAKLRRAVTTILLWAQSSLKVRADHKADSRTLC
Uniprot No.

Target Background

Function

This receptor may be involved in the perception of bitterness and is coupled to gustducin. It may also play a role in sensing the chemical composition of gastrointestinal contents. Receptor activation may stimulate alpha-gustducin, mediate PLC-β2 activation, and subsequently lead to TRPM5 channel gating.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R38 and what is its primary function in primates?

TAS2R38 is a G protein-coupled receptor that mediates bitter taste perception, particularly of compounds such as phenylthiocarbamide (PTC). This receptor plays a crucial evolutionary role in mammals by inducing innate avoidance behavior to potentially toxic substances, thereby preventing the ingestion of harmful compounds . In primates, including Pan troglodytes (common chimpanzee) and related species such as Pan paniscus (pygmy chimpanzee), TAS2R38 functions as part of a broader system of bitter taste receptors that helps distinguish between safe and potentially dangerous food sources .

What are the key structural features of the TAS2R38 gene and protein?

The TAS2R38 gene in Pan troglodytes encodes a protein of approximately 333 amino acids, similar to the 334 amino acids in humans. The gene contains a single coding exon of approximately 1002 base pairs, as observed in the pygmy chimpanzee (Pan paniscus) . The protein belongs to the TAS2R family of bitter taste receptors characterized by seven transmembrane domains typical of G protein-coupled receptors. Critical functional regions include the extracellular loops involved in ligand binding and intracellular domains that interact with G proteins to initiate signal transduction . Three key amino acid positions (49, 262, and 296) determine sensitivity to PTC, with the PAV haplotype (Proline-49, Alanine-262, Valine-296) conferring high sensitivity and the AVI haplotype (Alanine-49, Valine-262, Isoleucine-296) resulting in reduced sensitivity .

How is TAS2R38 expressed in different tissues beyond the gustatory system?

While traditionally associated with taste buds, TAS2R38 demonstrates significant extraoral expression across multiple tissue types. The expression profile varies considerably:

Tissue TypeRelative Expression LevelDetection Rate
Small IntestineHigh77%
TestisHighVariable
PancreasHighVariable
Transverse ColonHighVariable
Sinonasal EpitheliumModerateVariable
MuscleLow2.5%

TAS2R38 mRNA expression shows remarkable tissue-specificity, with a >300-fold range of expression values (0.0036–1.159 RPKM) across different tissues . Importantly, expression levels in one tissue do not predict expression in other tissues, with the exception of correlated expression between small intestine and colon . This tissue-specific expression pattern has significant implications for researchers working with recombinant systems, as it suggests the presence of tissue-specific regulatory mechanisms that should be considered when designing expression studies .

What are the primary functional variants of TAS2R38 in chimpanzees compared to humans?

In humans, TAS2R38 variants are well characterized, with the PAV/PAV genotype conferring high PTC sensitivity (tasters) and the AVI/AVI genotype resulting in reduced sensitivity (non-tasters) . Comparative analysis of Pan troglodytes TAS2R38 shows similar functional polymorphisms, though with some differences in frequency distribution.

The key functional variants include:

  • The taster variant (PAV haplotype) - associated with high sensitivity to PTC

  • The non-taster variant (AVI haplotype) - associated with reduced sensitivity

  • Less common variants (AAI, PVI, and AAV) - demonstrating intermediate sensitivity

While the specific distribution of these variants in Pan troglodytes populations has less documentation compared to humans, functional studies suggest conservation of the structure-function relationship across closely related primate species . Researchers working with recombinant chimpanzee TAS2R38 should account for these variants when designing experiments, particularly when interpreting differential responses to bitter compounds .

How do I determine which TAS2R38 variant is present in my sample?

Determining TAS2R38 variants requires sequence analysis focused on the three critical amino acid positions (49, 262, and 296). The recommended methodology includes:

  • PCR amplification of the TAS2R38 coding region

  • Sequence analysis with particular attention to positions corresponding to amino acids 49, 262, and 296

  • Comparison with reference sequences (such as accession XM_003813370.2 for Pan paniscus)

For recombinant expression studies, researchers should verify the sequence of their construct against reference databases to confirm the variant being studied. When working with cell lines or tissue samples from chimpanzees, direct sequencing of PCR products provides the most reliable determination of variants .

What are the optimal expression systems for recombinant Pan troglodytes TAS2R38?

For functional studies of recombinant Pan troglodytes TAS2R38, heterologous expression in mammalian cell lines provides the most physiologically relevant results. The recommended expression system includes:

  • Cell Line: HEK293T cells are widely used due to their high transfection efficiency and ability to properly process mammalian membrane proteins .

  • Vector System: The mammalian expression vector pEAK10 (Edge BioSystems, Inc.) has demonstrated success, though other vectors with strong promoters (CMV, EF1α) are also suitable .

  • Modifications for Surface Expression: Optimal expression requires N-terminal tagging with the first 45 amino acids of rat somatostatin receptor type 3 to facilitate cell-surface targeting, and C-terminal tagging with the last eight amino acids of bovine rhodopsin as an epitope tag .

  • Co-expression Requirements: Co-transfection with Gα16-gust44, a chimeric G protein, enables coupling of the receptor to calcium signaling pathways that can be measured in functional assays .

When establishing this system, researchers should verify expression through immunocytochemistry or western blotting before proceeding to functional assays, as surface expression can vary significantly between preparations .

How can I conduct functional assays for recombinant TAS2R38?

Calcium imaging represents the gold standard for functional characterization of TAS2R38. The methodology includes:

  • Cell Preparation:

    • Transiently transfect HEK293T cells with the TAS2R38 construct and Gα16-gust44 using Lipofectamine 2000

    • Plate cells on poly-D-lysine coated glass-bottom dishes at 70-80% confluency

    • Allow 24-48 hours for expression

  • Calcium Indicator Loading:

    • Load cells with a calcium-sensitive fluorescent dye (e.g., Fluo-4 AM)

    • Incubate for 30-60 minutes at room temperature

    • Wash thoroughly to remove excess dye

  • Stimulus Application:

    • Prepare phenylthiocarbamide in assay buffer (130 mM NaCl, 10 mM glucose, 5 mM KCl, 2 mM CaCl₂)

    • Apply stimulus solutions while monitoring fluorescence changes

    • Include positive controls (known activators) and negative controls (buffer alone)

  • Data Analysis:

    • Measure fluorescence intensity changes over time

    • Calculate dose-response relationships for different ligands

    • Compare responses between different TAS2R38 variants

This methodology allows for quantitative assessment of receptor function and comparison between different variants or species orthologs .

How does TAS2R38 function differ between human and chimpanzee orthologs?

Comparative functional analysis between human and chimpanzee TAS2R38 reveals both similarities and subtle differences:

  • Conservation of Key Functional Sites: Both species maintain the critical amino acid positions (49, 262, and 296) that determine PTC sensitivity, suggesting evolutionary conservation of the core sensing mechanism .

  • Response Profiles: Chimpanzee TAS2R38 generally exhibits response profiles to bitter compounds similar to those of human TAS2R38, though with potential differences in sensitivity thresholds and maximal response amplitudes that require careful calibration in comparative studies .

  • Variant Distribution: While both species exhibit taster and non-taster variants, the population distribution and frequency of these variants may differ, reflecting potentially different selective pressures during evolutionary history .

  • Regulatory Differences: Evidence suggests species-specific differences in the regulation of TAS2R38 expression across tissues, which may affect extraoral functions of this receptor .

These differences highlight the importance of species-specific characterization when working with recombinant TAS2R38, rather than assuming complete functional equivalence between human and chimpanzee orthologs .

What evolutionary insights can be gained from studying TAS2R38 variation across primates?

TAS2R38 variation provides valuable insights into evolutionary adaptation and dietary specialization in primates:

  • Geographical Adaptation: Studies of macaque species show evidence of geographical adaptation, with TAS2R38 variants showing both shared haplotypes (likely ancestral) and species-specific haplotypes, suggesting local adaptation to available food resources .

  • Functional Divergence in Allopatric Species: Examination of Sulawesi macaques revealed functional divergence of TAS2R38 among allopatric species, including truncated non-functional receptors in certain species, indicating potential relaxation of selective pressure or adaptation to different ecological niches .

  • Longevity Correlation: Research has identified associations between specific TAS2R38 variants (particularly the functional PAV/PAV genotype) and exceptional longevity in humans, suggesting potential roles beyond taste perception that may influence health and lifespan .

  • Balancing Selection: The maintenance of multiple functional variants across primate species suggests the action of balancing selection, potentially due to trade-offs between detecting beneficial and harmful compounds in different environments .

These evolutionary patterns provide context for understanding functional variation in recombinant TAS2R38 expression systems and may guide hypothesis generation for studies of extraoral functions .

How can TAS2R38 expression in extraoral tissues be accurately quantified?

Quantifying TAS2R38 expression in extraoral tissues presents several methodological challenges requiring specialized approaches:

  • RNA Extraction Optimization: Due to the low expression levels in many tissues, RNA extraction protocols should be optimized for recovery of low-abundance transcripts. This may include:

    • Using larger starting tissue amounts

    • Adding carrier RNA during extraction

    • Employing specialized low-input RNA isolation kits

  • Sensitive Detection Methods:

    • Quantitative RT-PCR with pre-amplification steps

    • Digital PCR for absolute quantification

    • RNA-seq with sufficient depth (>30 million reads per sample)

    • Digital droplet PCR for single-molecule detection

  • Reference Gene Selection: Careful validation of reference genes is essential, as conventional housekeeping genes may not show stable expression across all tissues expressing TAS2R38. Researchers should validate multiple reference genes for each tissue type studied .

  • Distinguishing Allelic Expression: For heterozygous samples, allele-specific quantification methods such as pyrosequencing or allele-specific qPCR can determine the relative expression of functional versus non-functional variants .

Intriguingly, research shows that tissue-specific expression patterns appear to be characteristic, with expression levels in one tissue not predicting levels in other tissues from the same individual. This suggests complex tissue-specific regulatory mechanisms controlling TAS2R38 expression .

What strategies can overcome challenges in functional characterization of TAS2R38 variants?

Functional characterization of TAS2R38 variants presents several technical challenges requiring specialized approaches:

  • Surface Expression Enhancement:

    • N-terminal fusion with the first 45 amino acids of rat somatostatin receptor type 3

    • C-terminal tagging with the last eight amino acids of bovine rhodopsin

    • Codon optimization for improved translation in mammalian cells

    • Lower incubation temperature (30°C instead of 37°C) during expression to aid proper folding

  • Signal Detection Optimization:

    • Co-expression with chimeric G proteins (Gα16-gust44) to couple receptor activation to calcium signaling

    • Use of high-sensitivity calcium indicators with low Kd values

    • Implementation of automated fluid handling systems for precise and reproducible stimulus delivery

    • High-speed imaging systems capable of detecting rapid and transient calcium signals

  • Addressing Low Response Amplitude:

    • Signal amplification through optimized cell density

    • Careful selection of positive and negative controls

    • Normalization to maximum receptor response

    • Statistical analysis methods appropriate for low signal-to-noise data

  • Validation Approaches:

    • Comparison with in vivo phenotypic data where available

    • Cross-validation with multiple functional assays (calcium imaging, cAMP assays, β-arrestin recruitment)

    • Correlation with structural predictions from molecular modeling

These methodological refinements significantly improve the reliability of functional characterization, particularly for variants with subtle functional differences .

How does TAS2R38 genotype influence immune function and disease susceptibility?

TAS2R38 genotype appears to influence multiple aspects of immune function and disease susceptibility beyond its role in taste perception:

  • Sinonasal Immunity: TAS2R38 is expressed in sinonasal epithelium where it contributes to pathogen defense. Research suggests that TAS2R38 genotype may predict:

    • Susceptibility to sinonasal infections

    • Surgical outcomes for sinonasal disease

    • Ex vivo biofilm formation capacity

  • Oral Health: Studies have identified correlations between TAS2R38 variants and dental health outcomes, including dental caries risk. This suggests a potential role in oral immunity or bacterial colonization patterns .

  • Longevity Association: Research has identified an increased frequency of the functional PAV/PAV genotype in centenarian and near-centenarian subjects compared to control cohorts, suggesting potential involvement in physiological mechanisms related to aging and longevity .

  • Mechanism Hypotheses: Several mechanisms may explain these associations:

    • Direct antimicrobial effects through detection of bacterial quorum-sensing molecules

    • Modulation of local immune responses

    • Influence on mucosal secretions

    • Alterations in microbial community composition

These findings suggest that recombinant TAS2R38 expression systems can serve as valuable models for investigating extraoral functions beyond taste perception .

How can I correlate TAS2R38 mRNA expression with protein abundance in different tissues?

Correlating TAS2R38 mRNA expression with protein abundance presents significant methodological challenges due to the generally low expression levels and the frequent discrepancies between mRNA and protein levels. A comprehensive approach includes:

  • Parallel Quantification Methods:

    • mRNA: RT-qPCR, RNA-seq, or digital PCR for sensitive detection

    • Protein: Western blotting with amplified detection systems, mass spectrometry with targeted approaches, or immunohistochemistry with signal amplification

  • Addressing Discrepancies: Research has noted mismatches between low TAS2R38 mRNA patterns (such as in GTEx data) and more abundant protein detection (Human Protein Atlas), suggesting important post-transcriptional regulation . Researchers should therefore:

    • Analyze polysome profiling data to assess translation efficiency

    • Investigate protein half-life through pulse-chase experiments

    • Examine miRNA regulation of TAS2R38 translation

    • Consider protein stabilization mechanisms

  • Tissue-Specific Considerations: Due to the tissue-specific nature of TAS2R38 expression, correlation analyses should be performed independently for each tissue type rather than assuming consistent relationships across different tissues .

  • Functional Validation: Ultimately, functional assays provide the most relevant information regarding the biological activity of TAS2R38 in different tissues, as neither mRNA nor protein abundance alone may fully predict receptor activity .

This comprehensive approach provides more reliable insights into the functional significance of TAS2R38 in different tissues than either mRNA or protein quantification alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.