Recombinant Pan troglodytes Taste receptor type 2 member 39 (TAS2R39)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Recombinant TAS2R39 is produced by inserting the Pan troglodytes (chimpanzee) TAS2R39 gene into expression systems such as E. coli or mammalian cells. Key characteristics include:

PropertyDetails
Host SystemE. coli (common), mammalian cells (e.g., HEK293)
TagN-terminal His tag for purification
LengthFull-length protein (1–338 amino acids)
Purity≥85% (verified by SDS-PAGE)
Storage-20°C/-80°C in aliquots

The protein’s UniProt ID is Q646A9 (chimpanzee ortholog), and it shares structural homology with human TAS2R39 (P59534) .

Ligand Specificity

TAS2R39 is activated by diverse bitter compounds:

Ligand ClassExamplesActivation Mechanism
Plant-derivedTheaflavins, soy isoflavonesHydrophobic interactions
PeptidesTrp-Trp, Leu-Leu-LeuStereospecific binding
Phenolic compoundsVanillinCalcium signaling via TRPM5

Physiological Roles

  • Taste Perception: Mediates bitterness detection in oral taste receptor cells via α-gustducin and PLCβ2 signaling .

  • Extraoral Functions:

    • Gut: Regulates gastric emptying and detects microbial metabolites .

    • Airways: Triggers immune responses to inhaled irritants .

Research Applications

Recombinant TAS2R39 enables:

  • Ligand Screening: Identification of agonists/antagonists via calcium flux assays (e.g., HEK293 cells co-expressing Gα16Gi/o44) .

  • Structure-Activity Studies: Analysis of binding pocket dynamics using mutagenesis (e.g., residues in TM3 and TM5) .

  • Comparative Genomics: Evolutionary studies across primates, highlighting conserved bitter sensing mechanisms .

Key Research Findings

  • Vanillin Activation: TAS2R39 is activated by vanillin (EC₅₀ ~3 mM), alongside TAS2R14 and TAS2R20, explaining bitter aftertastes in foods .

  • Dipeptide Sensitivity: Trp-Trp dipeptides activate TAS2R39, while Trp-Leu do not, indicating sequence-dependent recognition .

  • Pathogen Detection: Gut-expressed TAS2R39 may detect parasite-derived compounds, linking bitter sensing to immune surveillance .

Challenges and Opportunities

  • Structural Resolution: No crystal structures exist; reliance on computational models limits mechanistic insights .

  • Therapeutic Potential: Targeting TAS2R39 in gut or airway disorders requires deeper understanding of its signaling crosstalk .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
TAS2R39; Taste receptor type 2 member 39; T2R39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHA AEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIC TVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM AAYPAGHSILPIQDNPGLRRAWKRLQLRLHLYPKEWTL
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is linked to gustducin. It might contribute to sensing the chemical composition of gastrointestinal content. The receptor's activation may stimulate alpha gustducin, mediate PLC-beta-2 activation, and subsequently lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Pan troglodytes TAS2R39 and how does it compare to human TAS2R39?

Pan troglodytes TAS2R39 is a G protein-coupled receptor (GPCR) belonging to the bitter taste receptor family, responsible for detecting bitter compounds in chimpanzees. While specific information about chimpanzee TAS2R39 is limited in the provided data, human TAS2R39 shows notably low nucleotide diversity (0.005%) compared to other TAS2R genes, falling below the 5th percentile of genomic distribution . This suggests strong evolutionary conservation, which likely extends to its chimpanzee ortholog given the close phylogenetic relationship between humans and chimpanzees. Studies of taste receptors have shown significant sequence identity in taste receptor genes between chimpanzees and humans, which tends to correlate with similar taste responsiveness patterns .

What expression systems are most appropriate for recombinant Pan troglodytes TAS2R39?

For recombinant expression of TAS2R39, heterologous expression systems similar to those used for other bitter taste receptors would be appropriate. Based on methodologies used for taste receptor studies, mammalian cell lines like HEK293T cells represent an effective system for functional expression . For optimal expression, the receptor should be tagged (e.g., with Rho epitope at the N-terminus) to facilitate detection and localization studies. It's crucial to verify cell surface expression through immunocytochemistry, as some taste receptors may exhibit poor trafficking to the cell membrane, which would prevent proper functional characterization .

What methods can verify successful expression of recombinant Pan troglodytes TAS2R39?

Multiple complementary approaches should be employed:

  • qRT-PCR: To quantify mRNA expression levels of the recombinant receptor

  • Immunocytochemistry: Using antibodies against epitope tags to assess protein expression and localization before and after cell permeabilization, as demonstrated in mouse Tas2r studies

  • Western blotting: To confirm protein expression at the expected molecular weight

  • Flow cytometry: For quantitative assessment of cell surface expression levels

How can the functionality of recombinant Pan troglodytes TAS2R39 be assessed?

Functional assessment typically employs calcium mobilization assays in transfected cells expressing the receptor:

  • Calcium imaging: Cells expressing the receptor are loaded with calcium-sensitive fluorescent dyes (like Fura-2) and exposed to potential agonists. Receptor activation triggers calcium flux that can be quantified as changes in fluorescence (ΔF/F)

  • Concentration-response analysis: Testing compounds at multiple concentrations to determine:

    • Threshold concentrations for activation

    • EC50 values (half-maximal effective concentration)

    • Maximum efficacy (maximal response magnitude)

For comparative studies, standardized metrics should be established to evaluate both potency (concentration range for activation) and efficacy (strength of induced response), similar to the parameters used in mouse Tas2r characterization .

What are potential agonists for Pan troglodytes TAS2R39?

While specific agonists for Pan troglodytes TAS2R39 aren't defined in the provided data, potential candidates could be identified through:

  • Testing known agonists of human TAS2R39

  • Screening bitter compounds identified in foods relevant to chimpanzee diets

  • Testing plant compounds that might have co-evolved with primate bitter taste receptors

Given the behavioral importance of taste perception in primates, compounds related to potentially toxic plants in chimpanzee habitats would be priority candidates. Cross-species testing can also provide valuable insights, considering that taste responsiveness often correlates with phylogenetic relatedness .

What considerations are important when designing experiments to study ligand interactions with recombinant Pan troglodytes TAS2R39?

Rigorous experimental design should address several key factors:

  • Cell line selection: Choose cell lines with minimal endogenous bitter taste receptor expression to avoid false positives

  • Expression verification: Confirm receptor expression at the cell surface using immunocytochemistry before and after permeabilization

  • Positive controls: Include known bitter taste receptor agonists and receptors with established responses

  • Concentration ranges: Test compounds across broad concentration ranges (typically μM to mM) as activation thresholds can vary substantially

  • Response normalization: Standardize response measurements against positive controls to account for experiment-to-experiment variation

  • Receptor specificity: Test compounds against multiple bitter taste receptors to determine specificity profiles

Additionally, consider using multiple readout systems beyond calcium imaging (such as inositol phosphate accumulation or β-arrestin recruitment) to provide complementary functional data.

How can genetic diversity in TAS2R39 affect experimental results and interpretation?

Genetic diversity in taste receptors can significantly impact experimental outcomes. Human TAS2R39 shows unusually low nucleotide diversity (0.005%) compared to other TAS2R genes, falling below the 5th percentile of genomic distribution . This suggests strong evolutionary conservation. Additionally, human TAS2R39 demonstrates low population differentiation with an FST value of 0.01, which falls below expectation (PE = 0.026) .

For experimental planning, researchers should:

  • Sequence TAS2R39 from multiple Pan troglodytes individuals to assess natural variation

  • Consider using multiple variants if polymorphisms are identified

  • Compare results with human TAS2R39 variants to assess evolutionary differences

  • Interpret functional differences in the context of genetic conservation or divergence

This approach helps distinguish species-specific differences from individual variation and provides context for evolutionary interpretations.

What approaches can address cell surface expression challenges with recombinant TAS2R39?

Bitter taste receptors often show variable cell surface expression, which can complicate functional studies. Based on studies with mouse Tas2r receptors, several strategies can help improve membrane localization :

  • N-terminal modification: Addition of optimized signal sequences or rhodopsin-derived tags

  • Chaperone co-expression: Co-transfection with receptor transport proteins (RTPs) or receptor expression-enhancing proteins (REEPs)

  • Culture condition optimization: Temperature adjustment (30-33°C instead of 37°C) to facilitate proper folding

  • Codon optimization: Adapting the coding sequence to the expression system's preferred codon usage

  • Chimeric receptors: Creating fusion constructs with well-expressed GPCRs to improve trafficking

Receptor Modification StrategyAdvantagePotential Limitation
N-terminal taggingFacilitates detection and traffickingMay interfere with ligand binding
Chaperone co-expressionEnhances native folding and transportIntroduces additional variables
Temperature adjustmentSlows protein synthesis for better foldingMay affect cell physiology
Codon optimizationImproves translation efficiencyMay alter mRNA stability
Chimeric constructsLeverages trafficking signals from other GPCRsMay change receptor conformation

How can cross-species comparisons of TAS2R39 inform our understanding of bitter taste evolution?

Cross-species analysis of TAS2R39 can provide valuable evolutionary insights:

  • Sequence comparison: Align TAS2R39 sequences from humans, chimpanzees, and other primates to identify conserved domains and species-specific variations

  • Functional comparison: Test identical compounds on recombinant TAS2R39 from different species to identify shifts in sensitivity or specificity

  • Ecological correlation: Relate functional differences to dietary preferences and toxin exposure in natural habitats

  • Selective pressure analysis: Calculate dN/dS ratios to identify signatures of positive or purifying selection

This approach can reveal evolutionary adaptations in bitter taste perception related to specific ecological niches. For instance, studies comparing taste preferences between chimpanzees and spider monkeys revealed that chimpanzees' taste responsiveness correlates more strongly with human preferences, consistent with their closer phylogenetic relationship . The ranking order of sweetening potency for test substances correlates significantly between chimpanzees and humans, but not between spider monkeys and humans, highlighting the importance of both phylogeny and dietary adaptations .

What methodologies can be used to study the structure-function relationship of TAS2R39?

Several complementary approaches can elucidate structure-function relationships:

  • Site-directed mutagenesis: Systematically modify key amino acids to assess their role in receptor function

  • Chimeric receptors: Create hybrid receptors between human and chimpanzee TAS2R39 to identify domains responsible for species-specific responses

  • Homology modeling: Develop structural models based on known GPCR structures

  • Molecular dynamics simulations: Predict ligand-receptor interactions and conformational changes

  • Cysteine accessibility studies: Probe accessibility of residues in different receptor states

Results should be interpreted in the context of evolutionary conservation. For TAS2R39, which shows low nucleotide diversity in humans , focus should be given to highly conserved regions when investigating critical functional domains.

How can functional differences between Pan troglodytes TAS2R39 and human TAS2R39 be quantified?

Quantitative comparison requires standardized metrics across multiple parameters:

  • Agonist profile comparison:

    • Document receptor-specific agonists (compounds that activate only one species' receptor)

    • Identify shared agonists with differential potency or efficacy

    • Calculate overlap coefficients for agonist recognition profiles

  • Activation parameters:

    • Compare EC50 values for shared agonists

    • Analyze threshold concentrations for receptor activation

    • Measure maximum response amplitudes (efficacy)

  • Statistical analysis:

    • Calculate correlation coefficients for potency ranks across species

    • Perform principal component analysis to visualize species-specific response patterns

    • Apply hierarchical clustering to group receptors by functional similarity

Similar approaches have been used to compare sweet taste perception between chimpanzees and other primates, revealing that the ranking order of sweetener potency correlates significantly between chimpanzees and humans but not between spider monkeys and humans .

What approaches can determine if Pan troglodytes TAS2R39 exhibits polymorphism similar to other TAS2R genes?

To investigate potential polymorphism in Pan troglodytes TAS2R39:

  • Sequencing from multiple individuals: Collect DNA samples from diverse chimpanzee populations

  • Diversity metrics calculation: Determine nucleotide diversity (π), number of segregating sites (S), and population substructure (FST)

  • Comparison with genomic background: Calculate percentile ranks relative to genome-wide distributions

  • Comparison with human data: Contrast diversity patterns with human TAS2R39, which shows unusually low diversity (0.005%, below 5th percentile)

  • Functional testing of variants: Express identified variants to test for functional differences

How should researchers interpret contradictory data when comparing in vitro TAS2R39 responses with behavioral studies?

Discrepancies between cellular and behavioral data require careful interpretation:

  • Receptor context considerations: In vitro systems lack the complete cellular environment of taste cells

  • Signal integration effects: Behavioral responses reflect integration of signals from multiple receptors

  • Concentration relevance: Ensure tested concentrations are physiologically relevant

  • Compensatory mechanisms: Consider redundancy in bitter taste perception systems

  • Species-specific processing: Neural processing of taste information may differ between species

When interpreting such discrepancies, researchers should recognize that taste perception involves complex integration of signals from multiple receptors. For example, mouse studies show that different Tas2r receptors respond to overlapping sets of compounds with varying efficacies and potencies , allowing redundancy in bitter compound detection.

How can recombinant Pan troglodytes TAS2R39 research contribute to evolutionary biology?

Comparative studies of TAS2R39 between humans and chimpanzees can:

  • Identify signatures of selection by comparing sequence conservation and diversity patterns

  • Reveal adaptations related to dietary specialization and toxin avoidance

  • Provide insights into the timeline of bitter taste receptor evolution in the human lineage

  • Clarify co-evolutionary relationships between primate taste receptors and plant compounds

The low nucleotide diversity observed in human TAS2R39 (0.005%) suggests strong evolutionary conservation, raising questions about whether similar conservation exists in chimpanzees and what selective pressures might maintain this conservation.

What experimental controls are essential when characterizing recombinant Pan troglodytes TAS2R39?

Robust experimental design requires several critical controls:

  • Expression verification controls:

    • Positive control for antibody/tag detection

    • Cell surface expression confirmation through immunocytochemistry before and after permeabilization

  • Functional assay controls:

    • Vehicle-only negative control

    • Positive control using well-characterized bitter taste receptor-agonist pairs

    • Mock-transfected cells to control for endogenous responses

  • Specificity controls:

    • Testing agonists on multiple bitter taste receptors

    • Dose-response relationships to establish threshold concentrations

    • Antagonist studies to confirm receptor-mediated effects

These controls are essential to distinguish true receptor-mediated responses from artifacts and to enable meaningful cross-species comparisons.

How can intersectional approaches combining genetics and functional studies enhance TAS2R39 research?

Integrating multiple methodologies provides richer insights:

  • Genotype-phenotype correlations: Link genetic variants to functional differences in receptor activation

  • Ecological genomics: Correlate genetic variations with habitat and dietary specializations

  • Transcriptomics with functional validation: Combine expression profile analysis with receptor function studies

  • Structural biology and functional testing: Connect predicted structural features with experimental response data

This intersectional approach could help explain why human TAS2R39 shows such low nucleotide diversity and whether this pattern is shared with chimpanzees, potentially revealing specific selective pressures on this receptor.

What considerations are important when selecting a reference sequence for Pan troglodytes TAS2R39 cloning?

Careful selection of reference sequences is critical:

  • Genome version verification: Confirm which Pan troglodytes genome assembly is being used

  • Population representation: Consider whether the reference represents a single individual or consensus sequence

  • Annotation quality assessment: Evaluate evidence supporting the gene model (transcriptomic data, conservation)

  • Comparative verification: Cross-check with human TAS2R39 and other primate sequences

  • Functional domain verification: Ensure conserved GPCR domains are intact

This approach minimizes the risk of working with incorrectly annotated sequences. Similar considerations were applied in human TAS2R studies, where sequences were obtained from the Ensembl hg19/GRCh37 human genome assembly .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.