Recombinant Pan troglodytes Taste receptor type 2 member 41 (TAS2R41)

Shipped with Ice Packs
In Stock

Description

Introduction to Taste Receptor Type 2 Member 41

Taste receptor type 2 member 41 (TAS2R41) belongs to the broader family of bitter taste receptors that are essential for the detection and response to bitter compounds, primarily those found in potentially toxic substances. Recombinant Pan troglodytes TAS2R41 specifically refers to the artificially produced version of this receptor protein found naturally in chimpanzees (Pan troglodytes) . The receptor is part of a complex sensory system that has evolved to protect animals from consuming harmful substances, particularly plant secondary metabolites and toxic compounds .

Bitter taste perception serves as a critical protective mechanism across primate species, with TAS2R41 being one of several bitter taste receptors that have been identified in chimpanzees. These receptors function as warning systems, triggering aversive responses to potentially harmful substances, thereby playing a significant role in dietary selection and survival . The study of recombinant forms of these receptors enables researchers to investigate their structural and functional properties in controlled laboratory settings without the need for invasive procedures on living animals.

Gene and Protein Structure

The TAS2R41 gene in Pan troglodytes encodes a G-protein-coupled receptor characterized by seven transmembrane domains, which is typical of the taste receptor family . In commercial recombinant versions, the protein is often expressed with specific tags to facilitate purification and application in laboratory settings . The recombinant protein typically represents the complete or partial sequence of the native receptor, maintaining its essential structural features.

Recombinant Pan troglodytes TAS2R41 is also commercially known by alternative designations, including T2R41, and shares significant homology with taste receptor proteins found in related primate species . The gene structure reveals evolutionary conservation among closely related primate species, with specific variations that likely account for species-specific bitter taste perception abilities.

Biochemical Properties and Purity

Table 1: Biochemical Properties of Recombinant Pan troglodytes TAS2R41

PropertySpecificationMethod of Determination
Purity≥85%SDS-PAGE
Expression SystemCell-Free ExpressionN/A
Molecular Weight~35 kDa (estimated)Calculated from amino acid sequence
SolubilityVariable (dependent on buffer)Multiple buffer testing
Storage StabilityTypically -80°C for long-termStability testing at various temperatures

Commercial preparations of recombinant Pan troglodytes TAS2R41 typically achieve a purity level greater than or equal to 85% as determined by SDS-PAGE analysis . This level of purity is generally sufficient for most research applications, including functional studies and antibody production. The recombinant protein retains the key structural features necessary for function, including the crucial transmembrane domains and binding sites that determine bitter taste substance recognition.

Cell-Free Expression Systems

Recombinant Pan troglodytes TAS2R41 is predominantly produced using cell-free expression systems, which offer several advantages over traditional cell-based expression methods, particularly for membrane proteins like taste receptors . Cell-free systems bypass the challenges associated with membrane protein toxicity to host cells and difficulties in proper folding and insertion into membranes.

The ALiCE® system (Almost Living Cell-Free Expression System), based on lysates from Nicotiana tabacum, represents one potential approach for producing recombinant taste receptors . This system contains all necessary protein expression machinery, allowing for the synthesis of complex membrane proteins like TAS2R41 while maintaining their structural and functional integrity. Cell-free systems also permit the incorporation of specific modifications or tags, such as Strep tags, which facilitate subsequent purification and detection in experimental settings .

Alternative Expression Platforms

Table 2: Comparison of Expression Systems for Recombinant TAS2R41

Expression SystemAdvantagesLimitationsTypical Yield
Cell-Free ExpressionRapid production, Handles toxic proteins, Direct access for optimizationHigher cost, Limited post-translational modificationsModerate
E. coliCost-effective, Fast growth, Well-establishedLimited post-translational modifications, Inclusion body formationVariable
YeastEukaryotic post-translational modifications, Secretion capacityLonger production time, HyperglycosylationModerate-High
Baculovirus/Insect CellsAdvanced post-translational modifications, High expression levelsComplex process, Higher costHigh
Mammalian CellsNatural post-translational modifications, Proper foldingHighest cost, Longest production timeLow-Moderate

While cell-free expression is commonly used, recombinant Pan troglodytes TAS2R41 can also be produced using other expression platforms, including bacterial systems (E. coli), yeast, baculovirus/insect cells, or mammalian cell lines . Each system offers distinct advantages and limitations, with the choice largely depending on the specific research requirements. Factors influencing this selection include required yield, purity, post-translational modifications, and intended applications.

Phylogenetic Context

The evolution of taste receptor genes, including TAS2R41, is closely linked to dietary adaptations across primate species. Phylogenetic analyses of TAS2R genes across 35 primate species have revealed that these genes can be divided into 21 distinct clades, with certain duplications specific to anthropoids, Strepsirrhini, or Cercopithecidae . This evolutionary pattern reflects adaptation to different dietary niches and the selective pressures associated with detecting potentially toxic compounds in food sources.

Pan troglodytes TAS2R41 shares significant homology with corresponding genes in closely related species, including humans (Homo sapiens), bonobos (Pan paniscus), and gorillas (Gorilla gorilla) . This conservation suggests important functional roles that have been maintained through evolutionary processes, while species-specific variations may account for differences in bitter taste perception capabilities.

Dietary Adaptation and TAS2R41

Research indicates that the number and functionality of TAS2R genes in primates significantly correlate with dietary preferences . Species with herbivorous or omnivorous diets generally possess more functional TAS2R genes compared to carnivorous species, reflecting the greater diversity of potentially toxic plant compounds they encounter. This evolutionary pattern is evident in the TAS2R gene repertoire of Pan troglodytes, which has evolved to detect a range of bitter compounds found in their natural diet.

The evolutionary analysis of primate TAS2R genes, including TAS2R41, has revealed that closely related genes are often tandemly duplicated within the same genomic scaffold . This pattern suggests that the expansion of TAS2R gene families occurred through gene duplication events, providing the genetic raw material for the emergence of specialized receptors with species-specific relevance or diet-related functions.

Receptor Specificity and Binding

Bitter taste receptors exhibit varying degrees of specificity, with some being broadly tuned to detect multiple compounds while others are narrowly specialized for specific bitter substances . While the specific binding profile of Pan troglodytes TAS2R41 is not fully characterized based on the available search results, bitter taste receptors generally function by binding to bitter compounds, triggering signal transduction cascades that ultimately result in taste perception.

The functional properties of recombinant TAS2R41 make it valuable for studying receptor-ligand interactions, particularly in comparative studies with homologous receptors from other primate species. Such investigations can provide insights into the evolution of taste perception and dietary adaptations across different primate lineages.

Research Applications

Table 3: Research Applications of Recombinant Pan troglodytes TAS2R41

ApplicationDescriptionBenefits
Comparative Taste Perception StudiesInvestigating differences in bitter taste perception between chimpanzees and other primatesEvolutionary insights, dietary preference understanding
Receptor-Ligand Binding AssaysCharacterizing binding profiles with various bitter compoundsDrug development, toxicology applications
Antibody ProductionGenerating specific antibodies against TAS2R41Research tools, diagnostic applications
Structure-Function AnalysisDetermining critical residues for receptor functionFundamental bitter taste mechanism understanding
Expression StudiesInvestigating tissue distribution and expression levelsExtraoral functions discovery

Recombinant Pan troglodytes TAS2R41 serves as a valuable research tool for various applications in comparative biology, evolutionary studies, and sensory perception research. By providing access to a purified and consistent source of this protein, researchers can conduct detailed investigations without the need for invasive studies on protected primate species .

Extraoral Functions of TAS2R41

Beyond its role in taste perception, TAS2R41, like other bitter taste receptors, may participate in functions outside the oral cavity. Research on bitter taste receptors in general has revealed their presence in extraoral tissues, where they play roles in physiological processes unrelated to taste perception . For example, bitter taste receptors expressed in airway smooth muscle can mediate bronchodilation when activated by certain bitter compounds, potentially offering therapeutic targets for respiratory conditions.

While the specific extraoral functions of Pan troglodytes TAS2R41 are not explicitly detailed in the available research, the conservation of these receptors across species and their expression in multiple tissues suggest important physiological roles beyond taste. Investigations using recombinant TAS2R41 could help elucidate these potential functions in chimpanzees and provide comparative insights with human bitter taste receptors.

Technological Advances in Receptor Studies

Advancements in structural biology techniques, including cryo-electron microscopy and X-ray crystallography, offer promising approaches for resolving the three-dimensional structure of bitter taste receptors like TAS2R41. Such structural information would significantly enhance our understanding of receptor-ligand interactions and facilitate structure-based design of compounds that interact with these receptors for research or therapeutic purposes.

High-throughput screening methods, in combination with recombinant receptor expression, also present opportunities for identifying novel compounds that interact with TAS2R41. These approaches could reveal previously unknown ligands for this receptor and provide insights into its binding specificity and functional properties.

Comparative Genomics and Functionality

Expanded comparative studies across primate species could further illuminate the evolutionary history and functional significance of TAS2R41. Analysis of genetic variations, including copy number variations similar to those observed in other TAS2R genes , could reveal patterns of selection and adaptation in different primate lineages. Additionally, functional comparisons between TAS2R41 from different species could help identify species-specific adaptations in bitter taste perception capabilities.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize development of the specified tag.
Synonyms
TAS2R41; Taste receptor type 2 member 41; T2R41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MQAALTAFFMLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQL VGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHPTFL WLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPAYQEFLIRKFSVNMTYKWNTRIETYY FPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFL ILYALSFLSLIIDATKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLL ARGFWVA
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of the gastrointestinal contents. The activity of this receptor can stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Pan troglodytes TAS2R41 and how does it compare to human bitter taste receptors?

Pan troglodytes TAS2R41 is a G protein-coupled receptor (GPCR) that functions as a bitter taste receptor in chimpanzees. In humans, bitterness is perceived through a family of 25 bitter taste receptors (TAS2Rs) encoded by functional loci on chromosomes 5, 7, and 12 . Comparative genomic analyses reveal that TAS2R genes can vary significantly between primate species, with the total number ranging from 27 to 51 across different primates .

Phylogenetic studies show that closely related TAS2R genes are often tandemly duplicated on the same scaffold, indicating rapid evolutionary expansion through gene duplication . While specific data for P. troglodytes TAS2R41 is limited in the provided search results, it belongs to the broader family of bitter taste receptors that show significant variation across primate species due to dietary adaptations.

What are the structural characteristics of recombinant TAS2R41 that distinguish it from other bitter taste receptors?

Recombinant TAS2R41, like other TAS2R family members, functions as a GPCR with seven transmembrane domains. Proper trafficking to the plasma membrane is essential for its function, often requiring specialized signal sequences. Research on other TAS2Rs has shown that adding an N-terminal rat somatostatin receptor type 3 (SST3) signal sequence can promote receptor translocation to the plasma membrane .

The specificity of bitter taste receptors is determined by their binding pocket structure, which varies between different TAS2R subtypes. Some receptors, like human TAS2R5, are narrowly tuned (responding to few compounds), while others respond to a broader range of bitter compounds . Comparative analysis of binding pockets across species can reveal key structural adaptations that may relate to dietary preferences and evolutionary selection pressures.

How has the TAS2R gene family evolved in primates, and where does TAS2R41 fit in this evolutionary context?

The TAS2R gene family has undergone significant evolution in primates, with phylogenetic analysis revealing 21 distinct clades . This evolution appears to be driven primarily by dietary adaptations, as demonstrated by the significant correlation between the number of intact TAS2R genes and feeding preferences across primate species .

Molecular phylogeny studies of TAS2Rs show several patterns:

  • Species-specific duplications: Cercopithecidae species have developed specific TAS2R duplications during evolution

  • Clade-specific patterns: Some TAS2R clades are anthropoid-specific or Strepsirrhini-specific

  • Orthologous relationships: Some TAS2Rs maintain one-to-one orthologous relationships across species, while others exhibit gene expansion

While specific information about TAS2R41's exact position in this evolutionary context is not explicitly stated in the search results, it would likely share evolutionary patterns with other TAS2Rs in hominids. Birth-death model analyses of gene family evolution in vertebrates show varying rates of gene duplication and loss across lineages, which would impact the evolutionary trajectory of specific TAS2R genes like TAS2R41 .

What are the optimal expression systems for producing functional recombinant Pan troglodytes TAS2R41?

For functional expression of recombinant TAS2R41, heterologous mammalian cell systems are recommended based on successful approaches with other TAS2R proteins. Based on the methodologies described for other bitter taste receptors, the following system components are critical:

  • Expression vector selection: Systems allowing for co-expression of three key components:

    • Full-length TAS2R41 with an appropriate N-terminal signal sequence (such as rat somatostatin receptor type 3)

    • Gα16-gust44 chimera for functional coupling with phospholipase C

    • A calcium-reporting system (such as mt-clytin II)

  • Vector construction: Rather than using multiple separate vectors, a single vector containing all three components ensures consistent co-expression and improves reproducibility .

  • Cell line selection: Mammalian cell lines that do not endogenously express taste receptors (such as HEK293 cells) provide a clean background for functional studies.

This approach ensures proper receptor trafficking to the plasma membrane and coupling with appropriate signaling machinery, allowing for functional characterization of the receptor's response to potential ligands.

How can researchers optimize the N-terminal signal sequence to improve cell surface expression of recombinant TAS2R41?

Optimizing the N-terminal signal sequence is crucial for enhancing the functional expression of TAS2Rs at the plasma membrane. Research has shown that:

  • Signal sequence screening: Testing different N-terminal signal sequences can significantly improve the cell surface expression and functional response of TAS2Rs. The rat somatostatin receptor type 3 (SST3) signal sequence has been widely used, but alternative sequences may provide better results for specific TAS2R subtypes .

  • Sequence modification approach: A methodical approach involves:

    • Testing multiple signal sequence variants

    • Measuring receptor surface expression using immunofluorescence or flow cytometry

    • Correlating surface expression with functional response magnitude

    • Selecting the signal sequence that provides the largest assay window

  • Validation method: Researchers can compare the functional response (measured by calcium mobilization) of different signal sequence constructs to identify the optimal configuration. The best-performing constructs typically show enhanced signal-to-background ratios in functional assays .

This optimization process can increase the signal window for functional assays, improving sensitivity for ligand identification and characterization studies.

What are the key challenges in achieving functional expression of TAS2R41, and how can they be overcome?

Several challenges exist in the functional expression of bitter taste receptors like TAS2R41:

  • Poor surface trafficking: TAS2Rs often show inefficient trafficking to the plasma membrane in heterologous systems.

    • Solution: Screen multiple N-terminal signal sequences to identify those that enhance surface expression .

  • Variable co-transfection efficiency: When using multiple vectors, achieving consistent co-expression of all components is difficult.

    • Solution: Develop a single vector system containing all necessary components (receptor, G-protein chimera, and reporter) .

  • Limited assay sensitivity: Detecting receptor activation can be challenging, especially with weakly active compounds.

    • Solution: Use bioluminescence-based assays instead of fluorescence-based systems for improved signal-to-noise ratios and reduced susceptibility to interference .

  • Species-specific receptor behavior: Receptors from non-human species may have different folding and trafficking requirements.

    • Solution: Adapt expression systems based on knowledge of species-specific receptor properties, potentially incorporating chaperones or other proteins that may assist with proper folding.

What methodologies are most effective for screening potential ligands of recombinant Pan troglodytes TAS2R41?

Effective ligand screening for TAS2R41 requires sensitive and reproducible assay systems. Based on recent advances in the field, the following methodologies are recommended:

  • Bioluminescence-based calcium mobilization assays: These provide superior performance compared to fluorescence-based assays, with larger signal windows and better signal-to-noise ratios. They also avoid interference from autofluorescent compounds that might be present in plant or food extracts being tested as potential ligands .

  • Key components of an optimal screening system:

    • Heterologous expression of TAS2R41 with optimized signal sequence

    • Co-expression of Gα16-gust44 chimera for signaling

    • Mitochondrial-targeted calcium-binding photoprotein (mt-clytin II) as reporter

    • All components in a single vector for consistent expression

  • Dose-response characterization: Test compounds at multiple concentrations to determine EC50 values and efficacy parameters.

  • Comparative profiling: Compare responses to those of human orthologs to identify species-specific ligand preferences that may relate to dietary adaptations.

For compounds showing activity, follow-up characterization should include detailed pharmacological profiling to determine potency (EC50) and efficacy parameters.

How do the ligand profiles of Pan troglodytes TAS2R41 compare with those of human TAS2R orthologs?

While specific ligand profiles for Pan troglodytes TAS2R41 are not directly described in the search results, comparative analyses of bitter taste receptors across species reveal important patterns:

  • Ortholog identification: First determine if human TAS2R41 is a direct ortholog of P. troglodytes TAS2R41 through phylogenetic analysis, as some receptors may not have direct one-to-one relationships across species .

  • Shared vs. species-specific ligands: Similar to comparisons between human TAS2R5 and its functional homologs in other species, TAS2R41 likely has:

    • A set of conserved ligands that activate receptors across species

    • Species-specific ligands that reflect dietary adaptations

  • Comparative EC50 values: Even for shared ligands, potency (EC50) can vary significantly between species, reflecting evolutionary adaptations to different dietary needs and environmental exposures.

The specific relationship between chimpanzee TAS2R41 and human TAS2Rs would need to be established through direct functional comparisons, as has been done for other receptors like TAS2R5, which has no direct ortholog in some species but shares functional similarities with phylogenetically distant receptors .

What role does TAS2R41 play in bitter taste perception in Pan troglodytes, and how might this relate to dietary adaptations?

The role of TAS2R41 in Pan troglodytes bitter taste perception can be understood within the broader context of TAS2R evolution and dietary adaptation:

  • Evolutionary selection pressure: Phylogenetically independent contrast analysis has revealed significant correlations between the number of intact TAS2R genes and feeding preferences across primate species . This suggests that specific TAS2Rs, including TAS2R41, may have evolved in response to the need to detect particular bitter compounds in the chimpanzee diet.

  • Dietary specialization: Different TAS2R subtypes have evolved to detect specific classes of bitter compounds. The specific compounds detected by TAS2R41 would likely reflect bitter substances commonly encountered in the natural chimpanzee diet.

  • Comparative functional profiles: By comparing the functional responses of TAS2R41 to those of related receptors in humans and other primates, researchers can identify:

    • Compounds specifically detected by chimpanzee TAS2R41

    • Differences in sensitivity to shared ligands

    • Correlation between receptor properties and known dietary differences

This information would contribute to understanding how taste perception has shaped dietary preferences and food selection behaviors in different primate species, including potential adaptations to detect beneficial plant compounds or avoid toxic substances.

How can site-directed mutagenesis be used to identify key residues in TAS2R41 that determine ligand specificity?

Site-directed mutagenesis provides a powerful approach to understanding the molecular basis of TAS2R41 ligand specificity:

  • Methodology:

    • Identify candidate residues through sequence comparison with other TAS2Rs that have different ligand profiles

    • Generate point mutations of these residues in the recombinant TAS2R41

    • Functionally characterize each mutant using standardized assays

    • Compare EC50 values and efficacy parameters with wild-type receptor

  • Target selection strategies:

    • Focus on residues within transmembrane domains that likely form the ligand binding pocket

    • Investigate residues that differ between chimpanzee TAS2R41 and human orthologs

    • Examine conserved vs. variable regions across the TAS2R family

  • Expected outcomes:

    • Identification of specific residues that enhance or decrease sensitivity to particular ligands

    • Mapping of the functional binding pocket

    • Understanding of molecular mechanisms underlying species-specific ligand preferences

This approach has successfully identified key residues in other TAS2Rs and can reveal the molecular basis for differences in bitter compound perception between chimpanzees and humans.

What insights can chimeric receptor studies provide about the evolution of TAS2R41 across primate species?

Chimeric receptor studies, in which segments from different species' TAS2R41 are exchanged, offer valuable insights into evolutionary adaptations:

  • Experimental approach:

    • Generate chimeric receptors by exchanging domains between Pan troglodytes TAS2R41 and orthologs from other primates

    • Express these chimeras in heterologous systems using optimized methods

    • Screen against a panel of bitter compounds to map functional domains

  • Key questions addressed:

    • Which receptor domains determine species-specific ligand recognition?

    • How have specific segments evolved in response to dietary pressures?

    • What structural features are conserved across species despite sequence divergence?

  • Evolutionary interpretation:

    • Relating functional differences to dietary divergence between species

    • Identifying segments under positive selection

    • Understanding how gene duplication and diversification have shaped TAS2R function

These studies can reveal how specific TAS2R41 domains have adapted to detect compounds relevant to each species' ecological niche and dietary preferences.

How can comparative genomics approaches enhance our understanding of TAS2R41 function across different primate lineages?

Comparative genomics provides a broader evolutionary context for understanding TAS2R41 function:

  • Comprehensive phylogenetic analysis:

    • Analyze TAS2R41 sequences across diverse primate species

    • Identify patterns of conservation, duplication, and pseudogenization

    • Map gene gain/loss events onto the primate phylogenetic tree

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify segments under positive or purifying selection

    • Correlate selection patterns with known dietary shifts in primate evolution

    • Identify key adaptive mutations that may alter receptor function

  • Integration with ecological data:

    • Correlate TAS2R41 sequence variations with dietary preferences across species

    • Analyze relationship between receptor properties and plant compound exposure

    • Use phylogenetically independent contrast analysis to control for shared ancestry

This approach can reveal how TAS2R41 has evolved in different primate lineages and identify convergent adaptations in response to similar dietary pressures.

What controls and validations are necessary when conducting functional studies with recombinant TAS2R41?

Rigorous controls and validations are essential for reliable TAS2R41 functional studies:

  • Expression controls:

    • Confirm receptor expression through Western blotting or flow cytometry

    • Verify plasma membrane localization via immunofluorescence

    • Include non-transfected cells as negative controls

  • Functional validation:

    • Include known TAS2R agonists as positive controls

    • Use multiple concentrations to generate complete dose-response curves

    • Calculate and report EC50 values with appropriate statistical analysis

  • Specificity controls:

    • Test compounds on cells expressing empty vector

    • Include related TAS2Rs to confirm ligand specificity

    • Use receptor antagonists or signaling inhibitors to confirm mechanism

  • Technical considerations:

    • Standardize cell density and passage number

    • Control for compound autofluorescence or interference with assay components

    • Include replicates across multiple independent experiments

Implementing these controls ensures that reported functional data accurately reflect TAS2R41 properties rather than artifacts or non-specific effects.

How can researchers address the challenges of studying potentially autofluorescent compounds as TAS2R41 ligands?

Studying autofluorescent compounds presents unique challenges in TAS2R research:

  • Bioluminescence-based assays: These provide superior performance compared to fluorescence-based assays when testing autofluorescent compounds (such as plant extracts), as they avoid interference with the detection system .

  • Assay design considerations:

    • Use mitochondrial-targeted calcium-binding photoproteins like mt-clytin II as reporters

    • Express all components (receptor, G-protein, reporter) from a single vector

    • Include appropriate blank controls to account for background signals

  • Compound preparation protocols:

    • Test for intrinsic fluorescence of compounds before functional assays

    • Use concentration ranges that minimize interference

    • Consider alternative detection methods for highly autofluorescent samples

  • Data analysis approaches:

    • Subtract background signals from non-transfected cells

    • Use appropriate normalization to positive controls

    • Apply correction factors for known interference effects

These approaches enable reliable testing of plant-derived compounds and complex mixtures that might otherwise interfere with traditional fluorescence-based assays.

What are the best approaches for interpreting species differences in TAS2R41 function within an evolutionary context?

Interpreting species differences in TAS2R41 function requires integrating functional data with evolutionary analyses:

  • Comparative functional profiling:

    • Characterize TAS2R41 from multiple primate species under identical conditions

    • Generate comprehensive ligand response profiles for each ortholog

    • Quantify differences in both potency (EC50) and efficacy parameters

  • Sequence-function correlation:

    • Align sequences from multiple species

    • Identify amino acid differences correlating with functional differences

    • Use site-directed mutagenesis to confirm the role of specific residues

  • Phylogenetic context interpretation:

    • Map functional differences onto the primate phylogenetic tree

    • Determine whether functional shifts coincide with dietary transitions

    • Apply phylogenetically independent contrast analysis to control for shared ancestry

  • Ecological correlation:

    • Analyze the relationship between receptor properties and ecological factors

    • Consider the bitter compound profile of foods in each species' natural diet

    • Evaluate potential roles in detecting beneficial vs. toxic compounds

This integrated approach provides a comprehensive understanding of how TAS2R41 function has evolved in response to ecological pressures and dietary adaptations across the primate lineage.

How might recombinant TAS2R41 be used to study extraoral bitter taste receptor functions in chimpanzees?

Bitter taste receptors are now known to function beyond the oral cavity, with potentially important physiological roles:

  • Tissue expression profiling:

    • Analyze TAS2R41 expression across different chimpanzee tissues using RT-PCR or RNA-Seq

    • Compare expression patterns with human orthologs

    • Identify tissues with potentially important extraoral functions

  • Functional characterization in relevant cell types:

    • Express recombinant TAS2R41 in cell models representing tissues of interest

    • Assess responses to dietary and microbial compounds

    • Determine downstream signaling pathways activated in different cell types

  • Potential physiological roles to investigate:

    • Airway immunity and bronchodilation (if expressed in respiratory tissues)

    • Regulation of glucose homeostasis (if expressed in enteroendocrine cells)

    • Antimicrobial defense (if expressed in immune cells or mucosal surfaces)

These studies could reveal whether chimpanzee TAS2R41 serves similar extraoral functions as human TAS2Rs, which have been implicated in various physiological processes beyond taste perception.

What insights can comparative studies of TAS2R41 provide about the co-evolution of primates and plant defensive compounds?

Comparative studies of TAS2R41 can illuminate the evolutionary arms race between primates and plant defensive compounds:

  • Plant-primate co-evolutionary analysis:

    • Characterize TAS2R41 responses to compounds from plants in primate diets

    • Compare sensitivity to compounds from plants with longer vs. shorter co-evolutionary histories

    • Identify adaptations that may allow detection of novel plant toxins

  • Ecological correlation studies:

    • Analyze relationship between TAS2R41 properties and ecological factors

    • Compare receptor profiles of primates with different dietary specializations

    • Evaluate whether receptor adaptations correlate with exposure to specific plant families

  • Integrative approaches:

    • Combine receptor functional data with dietary analysis and plant chemistry

    • Assess temporal correlation between receptor evolution and plant diversification

    • Consider geographic patterns in receptor variation relative to plant distribution

These studies can reveal how bitter taste perception has shaped primate dietary choices and how plants may have evolved in response to primate feeding behaviors.

How can structures and functions of TAS2R41 inform pharmacological approaches to modulating bitter taste perception?

Understanding TAS2R41 structure and function can inform therapeutic approaches:

  • Molecular docking and virtual screening:

    • Generate homology models of TAS2R41 based on GPCR structures

    • Perform in silico screening to identify potential modulators

    • Design compounds that might selectively interact with specific receptor regions

  • Rational design of bitter blockers:

    • Identify key residues involved in ligand binding

    • Design compounds that competitively inhibit bitter compound binding

    • Develop allosteric modulators that alter receptor conformation or signaling

  • Comparative analysis for improved specificity:

    • Use differences between human and chimpanzee TAS2R41 to design species-specific modulators

    • Target regions unique to specific receptor subtypes to minimize off-target effects

    • Leverage evolutionary insights to predict compound interactions

  • Potential applications:

    • Developing bitter blockers for pharmaceutical applications

    • Designing compounds that modulate extraoral TAS2R functions

    • Creating research tools to study receptor signaling in different contexts

These approaches can translate fundamental knowledge about TAS2R41 structure and function into practical applications for both research and potential therapeutic interventions.

How can emerging protein structure prediction tools advance our understanding of TAS2R41 structure-function relationships?

Recent advances in protein structure prediction offer new opportunities for TAS2R41 research:

  • AI-based structure prediction:

    • Apply tools like AlphaFold2 to predict TAS2R41 structure

    • Compare predicted structures across primate species

    • Identify structural features that may correlate with functional differences

  • Integrative modeling approaches:

    • Combine homology modeling with experimental constraints

    • Use site-directed mutagenesis data to validate and refine structural models

    • Apply molecular dynamics simulations to study receptor flexibility and ligand interactions

  • Structural analysis applications:

    • Identify potential ligand binding pockets

    • Map species-specific variations onto predicted structures

    • Design mutations to test structure-based hypotheses about ligand specificity

These approaches can overcome the historical challenges of obtaining experimental structures for GPCRs and provide new insights into the molecular basis of TAS2R41 function.

What novel functional assay technologies could enhance our ability to characterize TAS2R41 pharmacology?

Emerging technologies offer improved approaches for TAS2R41 functional characterization:

  • Real-time measurement systems:

    • FRET-based biosensors for continuous monitoring of receptor activation

    • Label-free technologies such as dynamic mass redistribution (DMR)

    • Impedance-based cellular assays for integrated response measurement

  • High-throughput screening platforms:

    • Automated liquid handling for dose-response profiling

    • Multiplexed assays testing multiple receptors simultaneously

    • Image-based high-content screening for spatial response information

  • Single-cell analysis approaches:

    • Microfluidic systems for measuring responses at the single-cell level

    • Correlation of receptor expression levels with functional responses

    • Analysis of cell-to-cell variability in receptor signaling

These technologies can provide more detailed insights into TAS2R41 pharmacology, including kinetic parameters, signaling bias, and response heterogeneity.

How might CRISPR/Cas9 genome editing facilitate comparative studies of TAS2R41 function across primate species?

CRISPR/Cas9 technology offers powerful approaches for comparative TAS2R studies:

  • Receptor humanization in model organisms:

    • Replace mouse Tas2r genes with chimpanzee TAS2R41

    • Create "humanized" receptor variants in cellular models

    • Develop knock-in models expressing tagged receptors for localization studies

  • Precise genetic modification studies:

    • Create specific point mutations to test evolutionary hypotheses

    • Introduce naturally occurring variants to assess functional consequences

    • Generate receptor chimeras to map functional domains

  • Regulatory element analysis:

    • Edit upstream regulatory regions to study expression control

    • Assess the impact of species-specific promoter elements

    • Investigate epigenetic regulation of receptor expression

  • Physiological significance studies:

    • Create cell lines with knockout/knockin of TAS2R41

    • Assess impact on cellular responses to bitter compounds

    • Evaluate potential roles in immune function, hormone secretion, or other extraoral functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.