Recombinant Pan troglodytes Taste receptor type 2 member 43 (TAS2R43)

Shipped with Ice Packs
In Stock
Cat. No.
BT2143278
Source
in vitro E.coli expression system
Synonyms
TAS2R43; Taste receptor type 2 member 43; T2R43
Quick Inquiry

Description

Definition and Production of Recombinant Pan troglodytes Taste Receptor Type 2 Member 43 (TAS2R43)

Recombinant Pan troglodytes Taste receptor type 2 member 43 (TAS2R43) is a genetically engineered protein derived from chimpanzee (Pan troglodytes) genomic sequences. This recombinant protein is synthesized using heterologous expression systems to study its structural, functional, and pharmacological properties. It belongs to the TAS2R family of bitter taste receptors, which are G protein-coupled receptors (GPCRs) critical for detecting toxic compounds in food .

Key Production Parameters

ParameterDetails
Host SystemsCell-free expression, E. coli, yeast, baculovirus, or mammalian cells
Purity≥85% as determined by SDS-PAGE
Expression RegionFull-length or partial coding sequences (1–308 amino acids)
Tag InformationVariable: GST (N-terminal), His-tag, or other affinity tags
Storage BufferTris-based buffer with glycerol (50%)

Applications in Research and Drug Development

Recombinant TAS2R43 is utilized in:

  1. Bitter Taste Signaling Studies:

    • Investigating receptor-ligand interactions (e.g., caffeine-induced proton secretion in gastric cells) .

    • Screening antagonists/agonists for therapeutic applications (e.g., masking bitter flavors in medications) .

  2. Evolutionary and Comparative Genomics:

    • Analyzing sequence divergence between Pan troglodytes and Homo sapiens TAS2R43 to study bitter taste adaptation .

  3. Toxicity and Safety Testing:

    • Assessing receptor-mediated responses to carcinogens (e.g., aristolochic acid) .

Experimental Validation

Study TypeMethodologyOutcome
Antagonist ScreeningCa²⁺ mobilization assays in HEK-293T cellsHED inhibits TAS2R43 activation
CRISPR KnockoutGene editing in HGT-1 cellsReduced caffeine-induced acid secretion
Ligand ProfilingIn vitro binding assaysAliphatic aldehydes act as antagonists

Genetic and Population Diversity

While recombinant TAS2R43 studies focus on Pan troglodytes, population genetics data highlight its relevance:

  • Copy Number Variation (CNV): High-frequency deletions in human TAS2R43 (Δ43) correlate with altered bitter perception .

  • Nonsynonymous Polymorphisms: Amino acid substitutions in TAS2R43 may influence receptor function and disease susceptibility .

Genomic Context

FeatureDetails
Chromosomal LocationHuman: 12p13; Pan troglodytes: Syntenic region
Gene ClusterPart of the TAS2R30-31-43-45-46 cluster with high genetic diversity
Evolutionary ConservationHigh sequence similarity between primates (>95%)

Challenges and Future Directions

  • Structural Limitations: No resolved 3D structure for TAS2R43, hindering mechanistic studies .

  • Species-Specific Variability: Functional differences between Pan troglodytes and human TAS2R43 remain understudied .

  • Therapeutic Potential: Targeting TAS2R43 for bitter taste modulation in drug formulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TAS2R43; Taste receptor type 2 member 43; T2R43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
TAS2R43
Target Protein Sequence
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATSLSIFYLLKIANFSNFIFLH LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT MVANLVPFTLTLLSFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKVLQTVISFLLLCAI YFLSIMISVWSFGSLKNKPVFMFCKAMRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW VKGEKTSSP
Uniprot No.
Q646B4

Target Background

Function

Gustducin-coupled receptor involved in detecting bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the artificial sweeteners saccharin and acesulfame K. In airway epithelial cells, bitter compound binding elevates intracellular calcium ion concentration and stimulates ciliary beat frequency. It may function as a chemosensory receptor in airway epithelial cells, facilitating the detection and removal of potentially harmful agents from the airways.

Database Links

STRING: 9598.ENSPTRP00000054709

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.