Recombinant Pan troglodytes Taste receptor type 2 member 46 (TAS2R46)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pan troglodytes Taste Receptor Type 2 Member 46 (TAS2R46) is a genetically engineered protein derived from the bitter taste receptor gene of chimpanzees (Pan troglodytes). As a member of the G protein-coupled receptor (GPCR) family, TAS2R46 mediates bitter taste perception and extraoral chemosensory functions . Recombinant versions are produced by expressing the TAS2R46 gene in heterologous systems like E. coli, enabling large-scale studies of its structure, ligand interactions, and signaling mechanisms .

Production and Purification

Recombinant TAS2R46 is typically produced using the following methods:

ParameterDetails
Host SystemE. coli (most common), yeast, baculovirus, or mammalian cells .
TagN-terminal His-tag for affinity purification .
Purity≥85% (verified by SDS-PAGE) .
FormLyophilized powder .

For example, Creative BioMart offers full-length Pan troglodytes TAS2R46 (1-309 amino acids) expressed in E. coli .

Functional Roles

TAS2R46 serves dual roles in:

  • Taste Perception: Detects bitter compounds (e.g., strychnine, atropine) via gustducin-linked signaling cascades involving PLCβ2 and TRPM5 channels .

  • Extraoral Functions:

    • Regulates gastrointestinal motility and immune responses .

    • Modulates airway ciliary beat frequency and skeletal muscle activity .

Research Applications

Key studies leveraging recombinant TAS2R46 include:

ApplicationFindingsSource
Ligand ScreeningIdentified 68 ligands, including drugs like dextromethorphan, via calcium flux assays .
Molecular DynamicsNetwork analysis revealed TM3-TM6 correlations drive activation .
Therapeutic TargetingPatents describe modulators of TAS2R46 for treating metabolic and inflammatory disorders .

Comparative Analysis with Human TAS2R46

While chimpanzee and human TAS2R46 share >95% sequence identity, differences in ligand specificity exist:

AspectPan troglodytes TAS2R46Human TAS2R46
Expression HostsPrimarily E. coli Mammalian cells for functional studies .
Ligand ProfileBroadly tuned to sesquiterpene lactones Responds to strychnine, atropine, and drugs .

Future Directions

  • Mechanistic Studies: Explore TM3-TM6 conformational changes during ligand binding .

  • Therapeutic Development: Target TAS2R46 in gut-brain axis disorders or respiratory diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R46; Taste receptor type 2 member 46; T2R46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVSRVGLLW VLLLNWYATELNPAFYSIEVRITAYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLC LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT ILANLVPFTLTLISFLLLICSLCKHLEKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI YFLSIIMSVWSFESLENKPVFMFCEAITFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW VKGEKPSXP
Uniprot No.

Target Background

Function
This receptor potentially plays a role in perceiving bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of gastrointestinal contents. The receptor's activity may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5. In airway epithelial cells, binding of bitter compounds increases intracellular calcium ion concentration and stimulates ciliary beat frequency.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Q&A

What is the evolutionary significance of TAS2R46 diversification across chimpanzee subspecies?

The TAS2R46 gene exhibits remarkable subspecies-specific diversification across chimpanzee populations, reflecting adaptation to regional dietary repertoires. Approximately two-thirds of all cTAS2R haplotypes in amino acid sequences are unique to each subspecies . This diversification follows distinct evolutionary patterns:

  • In eastern chimpanzees (P. t. schweinfurthii): Purifying selection dominates the evolution of TAS2R genes in what's called the "human cluster" of cTAS2Rs

  • In western chimpanzees (P. t. verus): Balancing selection appears to drive TAS2R diversification

These divergent evolutionary mechanisms likely reflect adaptation to different food resources available across tropical Africa. The TAS2R46 gene specifically shows non-functionalization in eastern chimpanzees with high frequency (approximately 30%) through two independent mechanisms: pseudogenization and whole-gene deletion .

How does TAS2R46 non-functionalization correlate with dietary behaviors in eastern chimpanzees?

The high-frequency non-functionalization of TAS2R46 in eastern chimpanzees correlates with their unique dietary practices, specifically their consumption of bitter Vernonia species plants:

  • Eastern chimpanzees in Tanzania and Congo-Kinshasa regularly consume the pith of Vernonia species, including the medicinal plant Vernonia amygdalina (Asteraceae)

  • Western chimpanzees in Guinea avoid these same plants despite their presence in their environment

  • V. amygdalina contains bioactive sesquiterpene lactones with bitter taste properties

  • TAS2R46 recognizes many sesquiterpene lactones as specific ligands

This suggests that the loss of functional TAS2R46 may enable eastern chimpanzees to consume these bitter but potentially medicinal plants without experiencing aversive taste sensations.

What molecular dynamics approaches reveal the activation mechanisms of TAS2R46?

Researchers investigating TAS2R46 activation typically employ several complementary computational and structural biology techniques:

  • System setup for simulation:

    • Obtain receptor structures from databases (like RCSB Protein Data Bank, codes 7XP6 and 7XP4 for strychnine-bound and Apo states)

    • Model missing residues using resources like AlphaFold

    • Prepare three distinct states for comparison: Holo (ligand-bound active), Trans (ligand removed from active conformation), and Apo (inactive conformation)

  • Conformational stability analysis:

    • Calculate root-mean-squared deviation (RMSD) of backbone atoms over simulation time

    • Perform cluster analysis with linkage algorithm using RMSD between backbone atoms (0.15 nm cutoff)

    • Evaluate secondary structure probability for each residue

    • Compute root-mean-squared fluctuation (RMSF) of alpha carbons to assess residue mobility

  • Protein-ligand interaction characterization:

    • Use Protein-Ligand Interaction Profiler (PLIP) to identify key interactions

    • Calculate interaction probability by averaging occurrences across simulation frames

    • For TAS2R46 specifically, this revealed three main interactions with strychnine: hydrophobic interactions with Y85 and W88, and a salt bridge with E265

What structural features are critical for TAS2R46 activation upon ligand binding?

Molecular dynamics simulations have identified several key structural elements involved in TAS2R46 activation:

  • Transmembrane helices roles:

    • TM3 and TM6 are the main helices involved in structural signaling in the activated receptor state

    • TM6 shows reduced influence in signal transmission when the ligand is absent

  • Critical residues:

    • Y241 side-chain localization plays a crucial role in the activation process

    • This residue is not highly conserved among TAS2Rs, suggesting diverse activation mechanisms may exist in other TAS2R receptors

    • For ligand binding, Y85, W88, and E265 form the main interaction points with strychnine

  • Extracellular and intracellular loops:

    • ECL3 shows higher flexibility in the Trans state compared to Holo and Apo states

    • ICL3 exhibits similar flexibility in both Holo and Trans states but is more stable in the Apo state

    • ECL2 maintains similar fluctuation levels across all states but adopts a different conformation in the Apo state compared to Holo and Trans

How should researchers approach comparing TAS2R46 variants from different chimpanzee subspecies?

When investigating TAS2R46 variants across chimpanzee subspecies, researchers should implement a comprehensive experimental design that addresses:

  • Genetic sampling strategy:

    • Collect samples from all four putative chimpanzee subspecies (P. t. verus, P. t. schweinfurthii, etc.)

    • Ensure adequate sample sizes for each subspecies (the reference study examined 59 chimpanzees)

    • Consider geographical distribution within subspecies ranges to capture potential intra-subspecies variation

  • Variation characterization methods:

    • Sequence all TAS2R genes to identify single-nucleotide variations (SNVs)

    • Analyze insertions and deletions (indels)

    • Assess gene-conversion variations

    • Quantify copy-number variations (CNVs)

  • Functional validation approaches:

    • Express recombinant receptor variants in cell-based assays

    • Test functional differences using known ligands, particularly sesquiterpene lactones

    • Correlate functional differences with specific amino acid variations

    • Compare protein haplotypes with previously characterized human TAS2R variants with known functional effects

What methodologies enable accurate assessment of TAS2R46 binding pocket dynamics?

To effectively analyze TAS2R46 binding pocket characteristics, researchers should employ:

  • Binding pocket volume analysis:

    • Use computational tools like Epock to evaluate binding pocket volumes

    • Define the maximum englobing region (MER) as a sphere of radius 1.3 nm located at the center of mass of the ligand

    • Compare binding pocket volumes across different receptor states (Holo, Trans, Apo)

  • Network-based analytical approaches:

    • Implement network analysis to identify correlation patterns between residues

    • Map intra-protein correlations to understand how signal propagates through the receptor structure

    • Compare active vs. inactive states to identify activation-specific correlation networks

  • Combined experimental-computational strategy:

    • Validate computational predictions with site-directed mutagenesis of key residues

    • Test multiple ligands to determine binding pocket flexibility and specificity

    • Correlate binding pocket characteristics with activation efficiency

How can the study of TAS2R46 variants inform broader questions about sensory ecology in primates?

The investigation of TAS2R46 diversity provides a powerful model for understanding sensory adaptation to ecological conditions:

  • Comparative gustatory ecology:

    • Correlate TAS2R46 variants with detailed dietary repertoires across subspecies

    • Analyze plant chemical compounds in chimpanzee habitats to identify potential selective pressures

    • Compare TAS2R46 diversity patterns with other taste receptor genes to identify receptor-specific vs. general selection patterns

  • Cultural vs. genetic influences on diet:

    • Eastern chimpanzees consume Vernonia species with medicinal properties despite their bitterness

    • Western chimpanzees avoid these plants despite their availability

    • This pattern suggests an interplay between genetic adaptation (TAS2R46 non-functionalization) and cultural knowledge about plant properties

  • Methodological framework for future studies:

    • Integrate field observations of feeding behavior with molecular genetic analysis

    • Apply network-based approaches to understand structural signaling in different receptor variants

    • Use molecular dynamics simulations to predict functional differences before experimental validation

What are the implications of TAS2R46 research for understanding human taste perception evolution?

The study of chimpanzee TAS2R46 provides valuable insights into human taste perception evolution:

  • Comparative evolutionary trajectories:

    • Human TAS2R46 belongs to a cluster that shows purifying selection in eastern chimpanzees

    • Different selective pressures on this receptor across closely related species may explain species-specific taste preferences and dietary adaptations

    • The Y241 residue critical for TAS2R46 activation is not highly conserved across TAS2Rs, suggesting diverse activation mechanisms

  • Functional conservation and divergence:

    • Human TAS2R46 recognizes many sesquiterpene lactones as specific ligands, similar to the ancestral chimpanzee receptor

    • Differences in activation efficiency and ligand specificity between human and chimpanzee receptors may reflect divergent dietary adaptations

    • The network-based methodology employed for human TAS2R46 can be applied to chimpanzee variants to identify species-specific activation mechanisms

  • Future research directions:

    • Investigate whether different agonists trigger similar signal transduction mechanisms in human and chimpanzee TAS2R46

    • Apply molecular dynamics simulations to predict the functional consequences of subspecies-specific variations

    • Develop rational design approaches for compounds targeting oral or extra-oral TAS2Rs based on structural insights

What are the best practices for molecular dynamics simulation of TAS2R46?

When conducting molecular dynamics simulations of TAS2R46, researchers should follow these established protocols:

  • System preparation parameters:

    • Refine structures using specialized software like MOE to assign correct protonation states at neutral pH and physiological salt concentration (0.15 M)

    • Model missing residues using AlphaFold predictions after root-mean-square fitting on experimental structure alpha carbons

    • Prepare multiple starting states: ligand-bound (Holo), ligand-removed (Trans), and native inactive (Apo)

  • Simulation protocol:

    • Run multiple replicas (typically 3) of each system for statistical reliability

    • Ensure adequate equilibration time (approximately 100 ns based on previous studies)

    • Collect production data for at least 400 ns per replica

    • Validate structural stability through RMSD analysis, cluster analysis, and secondary structure probability assessment

  • Analysis techniques:

    • Use specialized tools like PLIP to evaluate protein-ligand interactions

    • Calculate binding pocket volumes using Epock or similar tools

    • Implement network-based approaches to identify correlation patterns and structural signaling pathways

    • Focus analysis on key functional regions: transmembrane helices, intracellular loops, and extracellular loops

How should researchers approach the functional characterization of recombinant TAS2R46 variants?

When expressing and functionally characterizing TAS2R46 variants, researchers should consider:

  • Expression system selection:

    • Heterologous expression in HEK293 cells has been successfully used for human TAS2R studies

    • Include appropriate trafficking signals and epitope tags for detection

    • Consider the use of chimeric G proteins to enhance coupling efficiency

  • Functional assay design:

    • Implement calcium imaging assays to measure receptor activation

    • Use dose-response curves to determine EC50 values for different ligands

    • Compare activation profiles across multiple ligands, particularly sesquiterpene lactones found in plants like Vernonia amygdalina

  • Complementary approaches:

    • Correlate in vitro functional data with computational predictions from molecular dynamics simulations

    • Apply site-directed mutagenesis to validate the role of specific residues identified in structural studies

    • Consider the impact of non-coding variations on expression levels and receptor trafficking

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.