Recombinant Pan troglodytes Taste receptor type 2 member 60 (TAS2R60)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pan troglodytes TAS2R60

Recombinant Pan troglodytes Taste receptor type 2 member 60 (TAS2R60) is a synthetic, genetically engineered protein derived from the bitter taste receptor family in chimpanzees. TAS2R60 belongs to the TAS2R gene family, which encodes G protein-coupled receptors (GPCRs) responsible for detecting bitter compounds in vertebrates . These receptors are critical for avoiding toxic substances and play roles in diverse physiological processes, including immune response and digestion . Recombinant TAS2R60 is produced in heterologous expression systems (e.g., E. coli, yeast, mammalian cells) to study its structure, function, and ligand interactions .

Production and Expression Systems

Table 2: Recombinant TAS2R60 Products (Pan troglodytes)

Product CodeDescriptionExpression System
CSB-CF723756EQVFull-length TAS2R60 proteinE. coli
CSB-YP723756EQV1Partial-length TAS2R60 proteinYeast
CSB-EP723756EQV1Full-length TAS2R60 with tags for purificationE. coli
CSB-MP723756EQV1Mammalian cell-expressed protein for higher eukaryotic compatibilityMammalian cells

These products are used in functional assays, ligand-binding studies, and structural analyses .

Role in Bitter Taste Perception

TAS2R60 is canonically associated with bitter taste detection, though its ligand specificity remains understudied compared to human TAS2R38 . Functional assays in amphibians suggest TAS2Rs may detect ecologically relevant toxins , implying potential conservation of function in primates.

Extraoral Expression and Physiological Roles

While primarily studied in taste buds, TAS2Rs (including TAS2R60) are expressed in gut, lung, and immune cells, where they regulate secretion, contraction, and immune responses . Recombinant TAS2R60 could serve as a model to study these non-canonical roles.

Evolutionary Context in Chimpanzees

Chimpanzee subspecies exhibit genetic diversification in TAS2R genes, influenced by dietary adaptations. Eastern chimpanzees (P. t. schweinfurthii) show purifying selection on TAS2Rs linked to human clusters, while western subspecies (P. t. verus) exhibit balancing selection . Such diversity may reflect evolutionary pressures on bitter compound detection in chimpanzee diets.

Challenges and Future Directions

  • Ligand Specificity: Limited data exist on chimpanzee TAS2R60’s ligand repertoire. Functional assays using recombinant proteins could identify bitterants relevant to primate ecology.

  • Structural Studies: Mammalian-cell-expressed TAS2R60 (e.g., CSB-MP723756EQV1) may enable high-resolution structural characterization .

  • Disease Implications: TAS2R dysregulation is linked to colon cancer and immune disorders in humans . Recombinant TAS2R60 could aid in cross-species comparative studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R60; Taste receptor type 2 member 60; T2R60; T2R56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLV SLGASHFCLQSVVMGKTIYVFLYPMAFPYNPVLQFLAFQWDFLNAATLWFSTWLSVFYCV KIATFTHPVFFWLKHKLSGWLPWMVFSYVGLSSFTTILFFIGNHRMYQNYLKNHLQPWNV TGNSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHMKKALLTTSGFREPSVQ AHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN CRLRAVLKSRRSSRCGTP
Uniprot No.

Target Background

Function

Recombinant Pan troglodytes Taste receptor type 2 member 60 (TAS2R60) is a receptor potentially involved in bitterness perception and linked to gustducin. It may also play a role in sensing gastrointestinal content composition. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R60 and what is its role in Pan troglodytes?

TAS2R60 (Taste receptor type 2 member 60) is a G-protein coupled receptor belonging to the T2R family in chimpanzees (Pan troglodytes). It functions as a bitter taste receptor, playing a crucial role in the detection of potentially harmful bitter compounds in the chimpanzee's diet. Like other taste receptors, TAS2R60 is involved in the conversion of chemical stimuli into cellular signals that are ultimately perceived as taste. The receptor belongs to a larger family of 25 receptors that can detect thousands of structurally diverse compounds, with each receptor generally broadly tuned to interact with numerous substances . This broad tuning requires binding pocket architectures that combine flexibility with selectivity, allowing chimpanzees to detect a wide range of potentially toxic compounds in their food sources .

What is the amino acid sequence and structural characteristics of Pan troglodytes TAS2R60?

Pan troglodytes TAS2R60 is a full-length protein characterized by its specific amino acid sequence that determines its three-dimensional structure and function. While the exact sequence of TAS2R60 is not explicitly provided in the search results, we can understand its structural characteristics based on related information. TAS2R60 belongs to the G-protein coupled receptor T2R family, which typically features seven transmembrane domains with intracellular and extracellular loops .

The receptor's binding pocket architecture is critically important for its function, as it must combine flexibility with selectivity to interact with diverse bitter compounds. The structure likely includes regions involved in ligand binding and G-protein coupling that are essential for signal transduction. Research on related TAS2R receptors has focused on determining the structure of binding pockets through generation of chimeric and mutant receptors, followed by calcium imaging analyses to identify critical receptor regions and amino acid residues . Similar approaches would be valuable for elucidating the specific structural characteristics of TAS2R60 that contribute to its unique agonist activation spectrum .

How does TAS2R60 compare to homologous receptors in other species?

TAS2R60 shows evolutionary conservation across multiple mammalian species, with homologs identified in various organisms. According to the available data, TAS2R60 homologs are present in several species including mouse (Tas2r135), rat (Tas2r135), pig (TAS2R60), and opossum (TAS2R60) . This conservation suggests the fundamental importance of this receptor in bitter taste perception across mammalian evolution.

Despite the conservation of the gene across species, there are likely important structural and functional differences that reflect the diverse dietary adaptations of these species. For instance, in mice and rats, the homologous receptor is designated as Tas2r135 rather than Tas2r60, which may indicate evolutionary divergence in the bitter taste receptor family . These differences could relate to the specific bitter compounds that each species encounters in its natural diet. Research methodologies to compare these homologs would include sequence alignment analysis, phylogenetic tree construction, and functional assays to compare agonist activation spectra across species. Such comparative studies would provide insights into the evolution of bitter taste perception and how it adapts to different ecological niches .

What genetic variations of TAS2R60 exist among different chimpanzee subspecies?

Significant genetic variations in TAS2R60 have been documented across different chimpanzee subspecies, reflecting their eco-geographical diversification. One notable variation is the Arg310His mutation in TAS2R60, which shows a high FST value of 0.818 between western and eastern chimpanzees. This high FST value indicates that the divergence in this SNV (Single Nucleotide Variation) is inconsistent with selective neutrality between these subspecies . The derived allele of this non-synonymous SNV is present only in eastern chimpanzees, suggesting a possible adaptive response to their specific ecological environment and dietary patterns .

Another significant variation found in TAS2R60 is a 2 bp deletion that renders the receptor non-functional. This mutation appears in central chimpanzees with an allele frequency of 50% and in Nigerian-Cameroonian chimpanzees with an allele frequency of 50%, but is absent in western and eastern chimpanzees . These findings suggest that TAS2R60 functionality may be under different selective pressures in different chimpanzee populations, potentially reflecting their distinct dietary adaptations across tropical Africa.

How can researchers analyze TAS2R60 nucleotide diversity and evolutionary selection?

Researchers investigating TAS2R60 nucleotide diversity and evolutionary selection should employ a multi-faceted methodological approach. First, PCR amplification and sequencing of TAS2R60 from multiple individuals across different chimpanzee subspecies provides the foundation for genetic analysis. The study in the search results employed this approach, analyzing samples from eastern, central, Nigerian-Cameroonian, and western chimpanzees .

For data analysis, researchers should calculate key population genetic parameters:

  • Nucleotide diversity (π) - measures the level of polymorphism within populations

  • Divergence (d) - quantifies differences between populations

  • FST values - indicates the degree of genetic differentiation between populations

High FST values, such as the 0.818 observed for the Arg310His mutation in TAS2R60, suggest that certain variants may be under positive selection in specific populations . To test for selective neutrality, researchers can perform statistical tests such as Tajima's D or Fu and Li's tests, which compare observed patterns of variation with those expected under neutrality.

Additionally, researchers should consider classifying TAS2R genes into appropriate evolutionary classes. As noted in the search results, primate TAS2R genes are classified into two classes: the human cluster and phylogenetically older TAS2Rs. These classifications reflect different evolutionary histories and selective constraints . Monte Carlo simulations can also be employed to reconstruct haplotype distributions and test hypotheses about population differentiation, as was done for western and eastern chimpanzee populations in the cited study .

What evidence suggests adaptive evolution of TAS2R60 in chimpanzee subspecies?

Several lines of evidence suggest adaptive evolution of TAS2R60 among chimpanzee subspecies, likely driven by their region-specific dietary adaptations across tropical Africa. The most compelling evidence comes from the Arg310His mutation, which shows an FST value of 0.818 between western and eastern chimpanzees . This high level of genetic differentiation is inconsistent with selective neutrality, suggesting that this non-synonymous change may have been driven by positive selection. The fact that the derived allele is present only in eastern chimpanzees indicates a potential adaptive response specific to their ecological environment .

The pattern of subspecies-specific haplotypes observed across TAS2R genes, including TAS2R60, further supports the hypothesis of adaptive evolution. Approximately two-thirds of all protein haplotypes were unique to each subspecies, suggesting marked diversification of TAS2R genes at the subspecies level . This diversification is significantly greater than expected under neutral evolution, as confirmed by Monte Carlo simulations, indicating that genetic drift and/or natural selection have played important roles in shaping the distribution of TAS2R haplotypes among chimpanzee subspecies .

How should researchers design expression systems for recombinant Pan troglodytes TAS2R60?

When designing expression systems for recombinant Pan troglodytes TAS2R60, researchers should carefully consider several key methodological aspects. First, the choice of expression system is critical. While the search results mention E. coli being used for expression of recombinant Pan troglodytes TAS2R4 (not TAS2R60) , it's important to note that G-protein coupled receptors (GPCRs) like TAS2R60 often require eukaryotic expression systems for proper folding and post-translational modifications. Common eukaryotic systems include HEK293 cells, CHO cells, or insect cell lines like Sf9.

For the construct design, researchers should include:

  • The full-length coding sequence of Pan troglodytes TAS2R60

  • Appropriate fusion tags (e.g., His-tag, FLAG-tag) to facilitate purification and detection

  • Kozak consensus sequence for efficient translation initiation

  • Signal peptides if secretion is desired

  • Codon optimization for the chosen expression system

The expression vector should contain strong promoters suitable for the host system (e.g., CMV promoter for mammalian cells). For functional studies, co-expression with appropriate G-proteins (typically Gα-gustducin for taste receptors) may be necessary to reconstitute the signaling pathway .

Purification strategies should be tailored to membrane proteins, potentially using detergents or nanodiscs to maintain protein stability and function. After expression and purification, the recombinant protein should be validated by western blotting, mass spectrometry, and circular dichroism to confirm identity, purity, and proper folding . Storage conditions should be optimized; based on protocols for similar proteins, storage at -20°C/-80°C in buffer containing glycerol (typically 5-50%) is recommended to maintain protein stability during freeze-thaw cycles .

What functional assays are most appropriate for studying Pan troglodytes TAS2R60 activation?

For studying Pan troglodytes TAS2R60 activation, researchers should employ a combination of functional assays that provide complementary information about receptor function. The most widely used approach is calcium imaging analysis, which was employed in the studies of related TAS2R receptors mentioned in the search results . This technique utilizes fluorescent calcium indicators to measure intracellular calcium release following receptor activation, providing a real-time readout of receptor function.

The experimental workflow for calcium imaging would typically include:

  • Transfection of cells (often HEK293T) with the TAS2R60 construct alongside necessary signaling components like G-proteins

  • Loading cells with calcium-sensitive dyes (e.g., Fura-2, Fluo-4)

  • Stimulating with potential agonists

  • Measuring fluorescence changes using fluorescence microscopy or plate readers

  • Analyzing dose-response relationships to determine EC50 values

Alternative or complementary functional assays include:

  • cAMP assays to measure G-protein signaling through adenylyl cyclase

  • β-arrestin recruitment assays to assess receptor internalization

  • Electrophysiological measurements in expression systems

  • BRET/FRET-based approaches to monitor protein-protein interactions

For more detailed structural insights, researchers could also employ binding assays with labeled ligands to determine binding affinities and kinetics. Furthermore, the generation of chimeric receptors by swapping domains between TAS2R60 and other TAS2Rs with known activation profiles can help identify critical regions for ligand specificity, as was done for related TAS2R receptors in the cited studies . Site-directed mutagenesis targeting specific amino acid residues, particularly those in predicted binding pockets or transmembrane domains, can further elucidate structure-function relationships .

How can researchers identify potential ligands for Pan troglodytes TAS2R60?

Identifying potential ligands for Pan troglodytes TAS2R60 requires a systematic approach combining computational predictions with experimental validation. Given that TAS2Rs generally are broadly tuned to interact with numerous substances , researchers should cast a wide net in their search for potential ligands.

A comprehensive methodology would include the following steps:

  • In silico prediction approaches:

    • Homology modeling based on related receptors with known ligands

    • Molecular docking simulations with libraries of bitter compounds

    • Pharmacophore modeling using known ligands of related TAS2Rs

    • Sequence comparison with human TAS2R60 and other species to identify conserved binding pocket residues

  • Comparative analysis with known TAS2R ligands:

    • Screen compounds known to activate orthologous TAS2R60 in humans or other primates

    • Consider ecological factors - test plant compounds found in the natural diet of Pan troglodytes

    • Evaluate compounds that activate TAS2Rs with high sequence similarity to TAS2R60

  • High-throughput experimental screening:

    • Calcium imaging assays using cells expressing TAS2R60 and appropriate G-proteins

    • Bitter compound libraries can be systematically tested at various concentrations

    • Dose-response curves should be generated for compounds showing activation

  • Structure-activity relationship studies:

    • For identified ligands, test structural analogs to map interaction requirements

    • Generate chimeric receptors between TAS2R60 and related TAS2Rs to identify ligand-binding regions

    • Use site-directed mutagenesis targeting predicted binding pocket residues, particularly focusing on the region containing the Arg310His mutation that shows evolutionary divergence between western and eastern chimpanzees

  • Validation of physiological relevance:

    • Compare activation patterns between different chimpanzee subspecies, especially focusing on receptors with and without the Arg310His mutation

    • Correlate findings with ecological and dietary information from different chimpanzee habitats

    • Consider the functional impact of the 2 bp deletion found in central and Nigerian-Cameroonian chimpanzees

This methodological framework allows for systematic identification of TAS2R60 ligands while also providing insights into the evolutionary and ecological significance of TAS2R60 variation across chimpanzee subspecies .

How can researchers generate and analyze chimeric and mutant TAS2R60 receptors?

Generating and analyzing chimeric and mutant TAS2R60 receptors is a sophisticated approach to map the structure-function relationship of this bitter taste receptor. Based on the methodologies described for related TAS2Rs, researchers should follow these detailed procedures:

For chimeric receptor generation:

  • Identify regions of interest by sequence alignment between TAS2R60 and related receptors with different activation profiles

  • Design chimeric constructs where specific domains (transmembrane regions, loops, N/C termini) are swapped between receptors

  • Use overlap extension PCR or restriction enzyme-based approaches to create the chimeric DNA constructs

  • Verify constructs by sequencing before expression

For site-directed mutagenesis:

  • Prioritize amino acid residues based on:

    • Conservation analysis across species

    • Presence in predicted binding pockets

    • Known polymorphisms, particularly the Arg310His variation observed between western and eastern chimpanzees

    • Proximity to the 2 bp deletion found in central and Nigerian-Cameroonian chimpanzees

  • Generate point mutations using standard site-directed mutagenesis techniques

  • Create multiple mutations to test additive or synergistic effects

  • Verify all constructs by sequencing

For functional analysis of chimeric and mutant receptors:

  • Express in appropriate cell systems alongside necessary signaling components

  • Perform calcium imaging analyses to assess receptor functionality

  • Test with a panel of potential agonists at various concentrations

  • Generate dose-response curves to determine EC50 values and efficacy parameters

  • Compare activation profiles with wild-type TAS2R60 and other related receptors

Data interpretation should focus on:

  • Identifying critical regions for general receptor function versus ligand specificity

  • Mapping the binding pocket architecture through systematic mutation analysis

  • Understanding the functional significance of natural variations like Arg310His

  • Correlating structural insights with evolutionary patterns observed across chimpanzee subspecies

This systematic approach will provide detailed insights into how the architecture of TAS2R60's binding pocket combines flexibility with selectivity to detect diverse bitter compounds, while also elucidating the functional consequences of natural genetic variations .

What techniques can be used to determine the structure of TAS2R60 binding pockets?

Determining the structure of TAS2R60 binding pockets represents one of the most challenging yet informative aspects of taste receptor research. Since direct structural determination of GPCRs like TAS2R60 is technically demanding, researchers should employ a multi-faceted approach combining computational, biochemical, and functional techniques.

Computational approaches:

  • Homology modeling based on related GPCRs with known structures

  • Molecular dynamics simulations to predict flexible regions and potential binding sites

  • Ligand docking studies to identify potential interaction sites

  • Sequence conservation analysis across species to identify functionally important residues

  • AI-based structure prediction tools like AlphaFold which have revolutionized protein structure prediction

Experimental approaches:

  • Systematic mutagenesis of predicted binding pocket residues followed by functional assays

  • Generation of chimeric receptors where domains are swapped between TAS2R60 and related receptors with different activation profiles

  • Cross-linking studies with photoactivatable ligands to identify binding sites

  • Hydrogen-deuterium exchange mass spectrometry to map ligand-induced conformational changes

  • For direct structural determination, though challenging, techniques such as:

    • X-ray crystallography of stabilized receptor constructs

    • Cryo-electron microscopy of receptor complexes

    • NMR studies of specific receptor domains

Functional validation:

  • Calcium imaging analyses to test the impact of mutations on receptor activation

  • Structure-activity relationship studies with series of chemically related ligands

  • Competition binding assays to distinguish between orthosteric and allosteric binding sites

  • Kinetic studies to characterize binding and activation mechanisms

By integrating these approaches, researchers can build a comprehensive model of the TAS2R60 binding pocket architecture. Special attention should be paid to the region containing the Arg310His mutation that shows significant divergence between western and eastern chimpanzees, as this may indicate adaptation of the binding pocket to different bitter compounds encountered in their respective environments . Understanding how TAS2R60's binding pocket combines flexibility with selectivity will provide crucial insights into how bitter taste receptors detect thousands of structurally diverse compounds using a limited number of receptors .

How does nucleotide variation in TAS2R60 impact receptor function across chimpanzee subspecies?

The relationship between nucleotide variation in TAS2R60 and receptor function across chimpanzee subspecies represents a fascinating case study in molecular adaptation. Based on the search results, several key variations have been identified that likely impact TAS2R60 function in different ways.

The most significant functional variation in TAS2R60 is the 2 bp deletion found in central and Nigerian-Cameroonian chimpanzees with an allele frequency of 50% in both subspecies . This deletion renders the receptor non-functional, suggesting a dramatic impact on bitter taste perception in these populations. The complete loss of function in half the individuals of these subspecies raises intriguing questions about the adaptive value of this variation. Researchers investigating this phenomenon should consider several hypotheses:

  • The non-functional allele may be adaptive if it eliminates sensitivity to bitter compounds that are prevalent but harmless in the diets of central and Nigerian-Cameroonian chimpanzees

  • Dietary toxins that would normally be detected by TAS2R60 might be absent in these regions, reducing selective pressure to maintain receptor function

  • Functional redundancy with other TAS2Rs might compensate for TAS2R60 loss

Another significant variation is the Arg310His non-synonymous SNV found exclusively in eastern chimpanzees . This mutation shows an FST value of 0.818, indicating strong divergence between western and eastern chimpanzees that is inconsistent with selective neutrality . While this mutation doesn't cause loss of function, it likely alters receptor properties. Experimental approaches to characterize its functional impact should include:

  • Expressing both variants in cell systems and comparing their activation profiles with various bitter compounds

  • Dose-response analyses to determine changes in sensitivity (EC50) and efficacy

  • Structural modeling to predict how the Arg-to-His substitution alters the binding pocket

  • Correlation with ecological data on plant secondary compounds present in eastern versus western chimpanzee habitats

To comprehensively understand how these variations impact receptor function, researchers should also consider the broader context of genetic diversity in TAS2R60 and other TAS2Rs. The observation that approximately two-thirds of all protein haplotypes were unique to each subspecies suggests marked diversification of TAS2Rs at the subspecies level . This pattern indicates that chimpanzee subspecies may have evolved distinct bitter taste perception profiles in response to their specific ecological niches and dietary patterns across tropical Africa .

What are the optimal storage and handling conditions for recombinant TAS2R60 protein?

Proper storage and handling of recombinant TAS2R60 protein is critical for maintaining its structural integrity and functional activity. Based on recommended protocols for similar recombinant proteins, researchers should implement the following methodological approaches:

Upon receipt of lyophilized recombinant TAS2R60:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being typical) to prevent damage during freeze-thaw cycles

  • Aliquot into smaller volumes to minimize repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

For working with the reconstituted protein:

  • Store working aliquots at 4°C for no more than one week

  • Avoid repeated freeze-thaw cycles as these can significantly reduce protein activity

  • When thawing, allow the protein to come to room temperature gradually

  • Handle with appropriate buffers, typically Tris/PBS-based buffer at pH 8.0

  • Include stabilizing agents such as trehalose (6% is recommended based on similar proteins)

For experimental considerations:

  • Prior to functional assays, verify protein integrity by SDS-PAGE (expect >90% purity)

  • For membrane proteins like TAS2R60, consider including mild detergents or lipid environments to maintain native conformation

  • In cell-based assays, ensure proper targeting to the cell membrane, possibly by co-expression with chaperone proteins

  • Include appropriate controls to account for potential batch-to-batch variations

These methodological recommendations are derived from protocols for similar recombinant proteins and represent best practices for maintaining the structural and functional integrity of recombinant TAS2R60 . Following these guidelines will help ensure experimental reproducibility and reliability in TAS2R60 research.

How can researchers troubleshoot expression and purification issues with recombinant TAS2R60?

Troubleshooting expression and purification issues with recombinant TAS2R60 requires a systematic approach addressing the unique challenges associated with membrane proteins like G-protein coupled receptors. Based on experience with similar proteins, researchers should consider the following methodological strategies:

For expression issues:

  • Low expression levels:

    • Optimize codon usage for the expression system

    • Try different promoters with varying strengths

    • Test multiple expression systems (bacterial, yeast, insect, mammalian)

    • Include fusion partners that enhance expression (e.g., MBP, SUMO, Thioredoxin)

    • Optimize induction conditions (temperature, time, inducer concentration)

  • Protein misfolding:

    • Express at lower temperatures (16-18°C) to slow folding and reduce aggregation

    • Co-express with molecular chaperones

    • Include ligands during expression to stabilize the native conformation

    • Use specialized host strains designed for membrane protein expression

    • Consider cell-free expression systems with lipid environments

  • Toxicity to host cells:

    • Use tightly regulated inducible promoters

    • Employ host strains with enhanced tolerance to membrane protein expression

    • Optimize cell density at induction time

    • Create fusion constructs that reduce toxicity

For purification issues:

  • Poor solubilization:

    • Screen multiple detergents systematically (ionic, non-ionic, zwitterionic)

    • Test detergent mixtures and novel solubilization agents (SMALPs, amphipols)

    • Optimize detergent concentration, temperature, and incubation time

    • Include stabilizing agents (glycerol, specific lipids, cholesterol)

  • Low purification yield:

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Try different affinity tags (His, FLAG, STREP) and tag positions

    • Test multiple purification strategies in sequence

    • Consider on-column refolding approaches

    • Perform scale-up optimization

  • Protein instability:

    • Include stabilizing ligands during purification

    • Test various buffer compositions with stabilizing additives

    • Utilize nanodiscs or liposomes for reconstitution

    • Consider protein engineering to improve stability

    • Optimize storage conditions to prevent aggregation and denaturation

For quality control at each step, implement analytical techniques such as Western blotting, size-exclusion chromatography, dynamic light scattering, and circular dichroism to assess protein quality. Additionally, functional assays specific to TAS2R60, such as ligand binding or activation studies, should be employed to confirm that the purified protein maintains its native structure and function.

By systematically addressing these potential issues, researchers can optimize the expression and purification of recombinant TAS2R60, facilitating structural and functional studies of this important bitter taste receptor .

What ethical considerations apply to research on Pan troglodytes TAS2R60?

Research on Pan troglodytes TAS2R60 involves several important ethical considerations that responsible researchers must address. These ethical dimensions span the acquisition of genetic material, the implications of findings, and broader conservation concerns.

Source material ethics:

  • Sample acquisition: Given that chimpanzees are endangered and protected species, researchers must ensure all genetic material is obtained ethically and legally. This typically means:

    • Using existing biobanked samples rather than collecting new samples

    • Utilizing non-invasive sampling methods if new collection is necessary

    • Obtaining proper permits and adhering to the Convention on International Trade in Endangered Species (CITES) regulations

    • Working with sanctuary, zoo, or research facility samples where available

  • Informed consent and governance:

    • When working with samples from captive chimpanzees, ensure proper institutional oversight

    • Respect the principles of animal welfare and the 3Rs (Replacement, Reduction, Refinement)

    • Consider the perspectives of stakeholders including conservation organizations and communities in chimpanzee range countries

Research implications:

Broader considerations:

  • Data sharing and accessibility:

    • Share sequence data and findings in public repositories to maximize research value

    • Consider how research benefits chimpanzee conservation efforts

    • Engage with relevant conservation organizations to ensure findings contribute to conservation knowledge

  • Reporting and communication:

    • Accurately represent the significance of findings without sensationalism

    • Contextualize research within conservation frameworks

    • Consider how findings might impact public perception and conservation support

By addressing these ethical considerations thoroughly, researchers studying Pan troglodytes TAS2R60 can ensure their work contributes positively to our understanding of chimpanzee biology while respecting the ethical responsibilities associated with research on endangered species .

What are the most promising avenues for future research on Pan troglodytes TAS2R60?

Future research on Pan troglodytes TAS2R60 presents several promising avenues that could significantly advance our understanding of bitter taste perception evolution and adaptation in primates. Based on current knowledge gaps and the findings presented in the search results, researchers should consider the following high-priority research directions:

  • Functional characterization of subspecies-specific variants:

    • Conduct comprehensive functional analyses comparing the wild-type TAS2R60 with the Arg310His variant found exclusively in eastern chimpanzees

    • Investigate the functional implications of the 2 bp deletion observed in central and Nigerian-Cameroonian chimpanzees that renders the receptor non-functional

    • Develop cellular assays that can accurately measure and compare activation profiles across variants

  • Ecological correlations with genetic variation:

    • Conduct systematic surveys of plant secondary compounds in the diets of different chimpanzee subspecies across their geographic ranges

    • Correlate the presence/absence of specific bitter compounds with TAS2R60 variants

    • Test whether the Arg310His mutation in eastern chimpanzees confers adaptive advantages for detecting specific compounds in their diet

    • Investigate why the loss-of-function 2 bp deletion might be maintained at high frequency (50%) in central and Nigerian-Cameroonian populations

  • Structural biology approaches:

    • Employ advanced structural determination techniques to elucidate the binding pocket architecture of TAS2R60

    • Compare binding pocket structures between variants to understand how the Arg310His mutation might alter ligand specificity

    • Use computational approaches like molecular dynamics simulations to predict how structural changes impact function

  • Comparative genomics and population genetics:

    • Expand sampling to include more individuals from each subspecies, particularly the less-studied Nigerian-Cameroonian and central chimpanzees

    • Apply population genetic analyses to determine whether TAS2R60 variants are under positive selection

    • Compare patterns of variation in TAS2R60 with other TAS2R family members to identify receptor-specific versus family-wide evolutionary patterns

  • Integration with behavioral and physiological studies:

    • Develop non-invasive methods to assess bitter taste perception in living chimpanzees

    • Connect genetic variations to actual food choice behaviors in different subspecies

    • Investigate whether TAS2R60 variants correlate with differences in physiological responses to bitter compounds

These research directions would significantly advance our understanding of how bitter taste receptor evolution contributes to dietary adaptation in our closest living relatives. Such knowledge has broader implications for understanding the coevolution of primate sensory systems with their ecological niches, as well as potential applications in conservation biology by highlighting the genetic uniqueness of different chimpanzee populations .

How might research on chimpanzee TAS2R60 inform our understanding of human taste perception?

Research on chimpanzee TAS2R60 offers valuable insights into human taste perception through comparative evolutionary analysis. This approach can illuminate both shared mechanisms and divergent adaptations in bitter taste perception between humans and our closest living relatives. Several specific research avenues would be particularly informative:

By pursuing these comparative approaches, researchers can leverage the natural genetic diversity of chimpanzee TAS2R60, particularly the well-documented subspecies variations , to gain deeper insights into human bitter taste perception. This evolutionary perspective is essential for understanding both the conserved mechanisms of taste perception shared across primates and the unique adaptations that characterize human sensory biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.