Recombinant Pan troglodytes Taste receptor type 2 member 7 (TAS2R7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pan troglodytes Taste Receptor Type 2 Member 7 (TAS2R7)

Recombinant Pan troglodytes Taste receptor type 2 member 7 (TAS2R7) is a synthetic version of the chimpanzee bitter taste receptor, expressed in heterologous systems such as E. coli or mammalian cells. As a member of the TAS2R family, it belongs to the G-protein-coupled receptor (GPCR) superfamily and plays a critical role in detecting bitter compounds, which often signal toxicity . This recombinant protein is used in functional studies to explore ligand binding, evolutionary adaptations, and receptor specificity .

Key Findings from Orthologous Studies:

  • Human TAS2R7:

    • Responds to ZnSO₄ (EC₅₀ = 3.21 mM), Al₂(SO₄)₃ (EC₅₀ = 1.2 mM), and MgCl₂ .

    • No activation by monovalent ions (e.g., KCl) .

  • Chimpanzee TAS2R7:

    • Likely retains similar ligand-binding residues due to sequence conservation .

Genetic Diversity and Evolutionary Insights

MetricWestern ChimpanzeeEastern ChimpanzeeBetween Subspecies
Nucleotide Diversity (π)0.0250.2950.214
Synonymous Diversity (πₛ)0.1090.197
Non-Synonymous Diversity (πₙ)0.0000.329

Data derived from concatenated TAS2R7 sequences .

This variation suggests balancing selection in western chimpanzees, potentially driven by dietary exposure to bitter plants .

Research Applications and Experimental Utility

Recombinant Pan troglodytes TAS2R7 is valuable for:

  1. Functional Assays: Testing ligand specificity in heterologous systems (e.g., HEK293 cells) .

  2. Evolutionary Studies: Comparing receptor repertoires across primates to infer dietary adaptations .

  3. Structural Biology: Mapping conserved residues critical for metal ion binding .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R7; Taste receptor type 2 member 7; T2R7; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYXFRIANFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLVATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQIG
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the perception of bitter compounds in the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Pan troglodytes TAS2R7?

TAS2R7 in chimpanzees is a G protein-coupled receptor with seven transmembrane domains (TM1-TM7), intracellular loops (ICL1-3), extracellular loops (ECL1-3), and a C-terminal domain. As with other taste receptors in the TAS2R family, it has no introns in its coding sequence. The receptor contains specific sequence motifs that are distinct from class A GPCRs, including F3.49Y3.50xxK3.53 and H7.49S/P7.50xxL7.53 motifs that are important for receptor activation .

How can researchers optimize expression of recombinant TAS2R7?

For optimal expression of recombinant TAS2R7, researchers should consider:

  • Signal sequence optimization: Adding N-terminal signal sequences from other GPCRs significantly improves cell surface expression. Studies show that the muscarinic acetylcholine M3 receptor (M3) signal sequence resulted in higher plasma membrane translocation than the traditionally used SST3 (somatostatin receptor 3) signal sequence .

  • Expression system selection: Cell-free expression systems can be used effectively to produce recombinant TAS2R7 with purity ≥85% as determined by SDS-PAGE .

  • Post-translational modifications: TAS2Rs generally have a consensus N-glycosylation site in the second extracellular loop that is important for receptor trafficking to the cell surface .

  • Codon optimization: This may improve expression levels in heterologous systems, especially when expressing chimpanzee proteins in human cell lines.

What are the genetic differences in TAS2R7 between chimpanzee subspecies?

Chimpanzee subspecies show significant genetic diversity in their TAS2R genes, including TAS2R7. Approximately two-thirds of all cTAS2R haplotypes in amino acid sequence are unique to each subspecies . The genetic variations include:

  • Single-nucleotide variations (SNVs)

  • Insertions and deletions (indels)

  • Gene-conversion variations

  • Copy-number variations (CNVs)

These differences likely reflect adaptation to subspecies-specific dietary repertoires across different regions of Africa .

What methods can be used to confirm the functionality of recombinant TAS2R7?

The functionality of recombinant TAS2R7 can be assessed using:

  • Bioluminescence-based calcium assays: These provide larger assay windows than fluorescence-based assays and can evaluate ligands within autofluorescent matrices .

  • Cell surface expression assays: HiBiT-tagging can be used to measure plasma membrane localization of TAS2R7 .

  • Dose-response relationships: Measuring EC50 values for known bitter ligands to confirm receptor-ligand interactions and functional responses .

  • In vivo association testing: This can confirm that the TAS2R genotype accurately predicts taster status, as demonstrated with TAS2R38 in chimpanzees .

How have evolutionary mechanisms shaped TAS2R7 in Pan troglodytes?

The evolution of TAS2R7 in chimpanzees has been shaped by several mechanisms:

  • Duplication events: TAS2R genes frequently occur in clusters, with batrachians (frogs and salamanders) having additional clusters and more genes per cluster compared to other vertebrates .

  • Recombination patterns: TAS2R clusters in many species occur near telomeres, regions with putatively higher rates of recombination .

  • Selection pressures: Different evolutionary backgrounds are observed among subspecies of chimpanzees:

    • Western chimpanzees (P. t. verus): Diversification may have resulted from balancing selection

    • Eastern chimpanzees (P. t. schweinfurthii): Purifying selection dominates the diversification of the "human cluster" of cTAS2Rs

  • Dietary adaptation: The diversification of TAS2Rs in chimpanzees likely reflects their subspecies-specific dietary repertoires .

What experimental design is optimal for studying ligand specificity of Pan troglodytes TAS2R7?

For studying ligand specificity, researchers should consider:

  • Ligand screening panel: Test a collection of biologically relevant natural bitter compounds, particularly those found in the natural diet of chimpanzees.

  • Mutagenesis studies: To identify key residues for ligand binding, researchers should target:

    • Transmembrane domains, particularly TM3, TM5, and TM7

    • Extracellular loops, especially ECL2

  • Comparative approach: Test the same compounds on human TAS2R7 and other TAS2R family members to establish specificity profiles .

  • Concentration-response curves: Determine EC50 values to quantify sensitivity differences .

How can researchers investigate the functional significance of TAS2R7 genetic variations identified in different chimpanzee populations?

To investigate functional significance of genetic variations:

  • Receptor variant library creation: Generate all identified natural variants using site-directed mutagenesis.

  • Functional characterization:

    • Measure response profiles to a standardized set of bitter compounds

    • Compare EC50 values and maximum response amplitudes

    • Assess cell surface expression levels of each variant

  • Structure-function analysis:

    • Map variants onto predicted 3D models of TAS2R7

    • Correlate location of variations with functional differences

  • Ecological correlation:

    • Document dietary preferences of different chimpanzee populations

    • Correlate receptor variant distribution with available food sources

    • Test receptor responses to compounds found in the local diet

  • Population genetics analysis:

    • Calculate FST values for TAS2R7 genetic variants

    • Test for signatures of selection using methods like Tajima's D or dN/dS ratios

What are the key challenges in developing a high-throughput screening system for TAS2R7 ligands?

Key challenges include:

  • Low expression levels: TAS2Rs typically express poorly in heterologous systems. Researchers should:

    • Test different signal sequences (M3 receptor signal sequence has shown promise)

    • Optimize codon usage for the expression system

    • Consider using tetracycline-inducible expression systems

  • Receptor trafficking issues:

    • Ensure proper N-glycosylation at the conserved site in ECL2

    • Consider co-expression with chaperone proteins

  • Signal detection sensitivity:

    • Bioluminescence-based calcium assays offer larger assay windows than fluorescence-based methods

    • Consider using amplification steps in the signaling cascade

  • Ligand solubility issues:

    • Many bitter compounds have limited solubility

    • Develop standardized protocols for preparing stock solutions

    • Test for compound interference with the assay system

  • Data interpretation complexities:

    • Account for potential auto-fluorescence of test compounds

    • Implement appropriate controls for non-specific effects

    • Develop algorithms to identify true positive hits

How does the genomic organization of TAS2R7 in Pan troglodytes compare with other primates?

The genomic organization of TAS2R7 in chimpanzees compared to other primates reveals important evolutionary patterns:

FeaturePan troglodytesHumansOther Great ApesNotable Findings
Chromosomal locationSimilar to human locationOften near telomeresVariableTAS2R genes are generally closer to chromosome ends in amphibians (mean = 0.148) compared to other vertebrates (mean = 0.202)
ClusteringPart of TAS2R gene clustersSimilar clusteringVariable clustering patternsClustered genes are located closer to telomeres (mean 0.18) than singleton genes (mean 0.24)
Copy numberVariable between subspecies25 TAS2R genes in humansVariableEastern chimpanzees have large-deletion variants affecting multiple TAS2R genes
Neighboring repeat elementsEnrichment patterns differ from humansEnrichment of LINEs, loss of SINEs near TAS2RsVariableNon-amphibian species show significant enrichment of LINEs (p = 0.0073) and loss of SINEs (p = 0.049) near TAS2Rs
Conserved neighboring genesBUSCO genes can identify orthologous lociSimilar patternsSome conservation across tetrapodsSome TAS2R clusters are surrounded by the same set of five BUSCOs in all four major tetrapod lineages

How can researchers design experiments to understand the co-evolution of TAS2R7 with dietary toxins specific to chimpanzee habitats?

To study co-evolution of TAS2R7 with dietary toxins:

  • Ecological sampling and analysis:

    • Survey plants consumed by different chimpanzee populations

    • Analyze bitter/toxic compound profiles using LC-MS/MS

    • Document feeding preferences and avoidance behaviors

  • Functional receptor testing:

    • Test recombinant TAS2R7 variants against compounds identified in the ecological survey

    • Measure sensitivity (EC50) and specificity of response

    • Compare responses between receptor variants from different subspecies

  • Parallel evolution analysis:

    • Look for convergent amino acid substitutions in TAS2R7 across populations with similar diets

    • Test if parallel substitutions cause similar functional changes, as seen in the K172N substitution in human and white-faced saki TAS2R16

  • Selection analysis:

    • Calculate dN/dS ratios for specific domains of TAS2R7

    • Identify sites under positive selection using models like PAML

    • Test if positively selected sites correspond to ligand-binding regions

  • Comparative transcriptomics:

    • Compare TAS2R7 expression patterns across tissues (beyond tongue)

    • Investigate if expression patterns correlate with detoxification pathways

    • Compare with expression patterns in other primate species

What methodological approaches can researchers use to analyze TAS2R7 expression patterns in non-taste tissues of chimpanzees?

Approaches for analyzing TAS2R7 expression in non-taste tissues:

  • qRT-PCR assays:

    • Design primers specific to TAS2R7 and reference genes

    • Sample multiple tissues (e.g., gut, respiratory epithelium, testes)

    • Use relative quantification with appropriate normalization controls

  • RNA-seq analysis:

    • Perform transcriptome sequencing of multiple tissues

    • Map reads to the TAS2R7 genomic locus

    • Calculate FPKM/TPM values to quantify expression levels

    • Analyze potential splice variants or alternative start codons

  • In situ hybridization:

    • Design RNA probes specific to TAS2R7

    • Perform tissue staining to localize expression

    • Use dual labeling to identify cell types expressing TAS2R7

  • Single-cell RNA sequencing:

    • Identify specific cell populations expressing TAS2R7

    • Analyze co-expression patterns with other taste signaling components

  • Western blotting and immunohistochemistry:

    • Use TAS2R7-specific antibodies to detect protein expression

    • Validate specificity with recombinant TAS2R7 controls

    • Quantify protein levels across different tissues

The proportion of TAS2R genes expressed in extra-oral tissues may correlate with the total TAS2R count in a species, suggesting important non-taste functions for these receptors .

How can researchers differentiate between the functional outputs of closely related TAS2R family members when expressed in the same cell system?

Differentiating between closely related TAS2Rs requires:

  • Selective agonists/antagonists:

    • Screen compound libraries for receptor-specific ligands

    • Design competitive binding assays to measure specificity

  • Chimeric receptor approach:

    • Create chimeras between TAS2R7 and related receptors

    • Map functional differences to specific receptor domains

  • siRNA knockdown strategy:

    • Use receptor-specific siRNAs to selectively reduce expression

    • Measure changes in response to bitter compounds

    • Validate knockdown efficiency with qPCR

  • CRISPR-Cas9 genome editing:

    • Generate cell lines with specific TAS2R knockout

    • Compare responses before and after knockout

    • Re-introduce mutated versions to confirm specificity

  • Bioinformatic prediction of specificity-determining residues:

    • Align sequences of closely related TAS2Rs

    • Identify non-conserved residues in ligand-binding regions

    • Verify through site-directed mutagenesis

  • Coupling to different signaling pathways:

    • Design assays for different G protein subtypes

    • Use BRET/FRET sensors to visualize specific G protein activation

    • Compare signaling kinetics and amplitudes

This approach has been validated with other TAS2R family members, such as TAS2R38, where genotype accurately predicts taster status in both humans and chimpanzees, albeit through different molecular mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.