Recombinant Pan troglodytes Taste receptor type 2 member 8 (TAS2R8)

Shipped with Ice Packs
In Stock

Description

Bitter Taste Perception

  • Oral Detection: Localized to taste bud cells, TAS2R8 initiates bitter taste transduction via G-protein α-gustducin, triggering PLCβ2 activation and calcium signaling through TRPM5 channels .

  • Broad Ligand Specificity: Responds to diverse bitter compounds, including toxins and pharmaceuticals, though exact agonists for chimpanzee TAS2R8 remain under investigation (inferred from human TAS2R8 studies) .

Extraoral Functions

  • Gastrointestinal Sensing: Modulates gut motility, hormone secretion (e.g., GLP-1), and nutrient absorption .

  • Immune Regulation: Detects bacterial quorum-sensing molecules in the gut and airways, influencing immune responses .

Recombinant Expression

  • Host Systems: Optimized for cell-free expression (≥85% purity) or heterologous systems like E. coli and mammalian cells .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C/-80°C; avoid freeze-thaw cycles .

Research Applications

  • Cancer Studies: Human TAS2R8 overexpression suppresses cancer stemness (e.g., neuroblastoma) by downregulating DLK1, CD133, and Sox2 .

  • Drug Development: Used to screen TAS2R8 antagonists like S6821/S7958, which block bitterness in pharmaceuticals .

  • Evolutionary Genetics: Comparative studies reveal subspecies-specific TAS2R diversification in chimpanzees (e.g., CNVs in P. t. schweinfurthii) .

Genetic Diversity in Chimpanzees

Subspecies of Pan troglodytes exhibit marked TAS2R haplotype variations:

  • Western Chimpanzees (P. t. verus): Balancing selection drives receptor diversity .

  • Eastern Chimpanzees (P. t. schweinfurthii): Purifying selection dominates in "human cluster" TAS2Rs .

Key Findings:

  • 67% of protein haplotypes are subspecies-specific .

  • Large deletions in TAS2R43/46/64 observed in eastern populations .

Interaction Network

TAS2R8 collaborates with signaling partners in taste and extraoral tissues:

ProteinRole in TAS2R8 Signaling
GNAT3Gα-gustducin subunit; activates PDE1A/PLCβ2
TRPM5Calcium-activated cation channel
PLCB2Mediates IP3 production for calcium release
TAS1R3Co-expressed in umami/sweet taste transduction

Source:

Challenges and Future Directions

  • Ligand Identification: High-throughput screens needed to map chimpanzee-specific TAS2R8 agonists/antagonists.

  • Therapeutic Potential: Explore roles in metabolic disorders (e.g., TAS2R8-linked gut-brain axis modulation) .

  • Evolutionary Insights: Link receptor diversification to ecological adaptations in wild chimpanzee populations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R8; Taste receptor type 2 member 8; T2R8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFXVSKIPYF EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF IFFFFLYFISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQIFVRML TCRKIACVI
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of gastrointestinal content. The activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.