Recombinant Pan troglodytes Tetraspanin-7 (TSPAN7)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

The biochemical properties of Recombinant Pan troglodytes TSPAN7 dictate its behavior in experimental settings and its potential applications in research. The recombinant protein typically achieves a purity level of greater than or equal to 85% as determined by SDS-PAGE analysis, ensuring reliable results in downstream applications . When produced through recombinant technology, the protein may include affinity tags such as His-tag to facilitate purification and detection, though these modifications are designed to minimize interference with the protein's native functions . The stability of the recombinant protein under various storage and experimental conditions represents an important consideration for researchers, with lyophilized forms offering extended shelf life compared to liquid preparations . Understanding these biochemical properties is essential for designing appropriate experimental protocols and interpreting results accurately in studies involving this recombinant protein.

Expression Systems

The choice of expression system for producing Recombinant Pan troglodytes TSPAN7 reflects a balance between yield, functionality, and research requirements. Bacterial expression systems such as E. coli offer advantages in terms of rapid growth, high protein yields, and cost-effectiveness, making them suitable for applications where post-translational modifications are less critical . Yeast-based systems provide an intermediate option, offering some eukaryotic processing capabilities while maintaining relatively high yields and moderate costs compared to more complex expression platforms . Baculovirus expression systems utilizing insect cells represent a step closer to mammalian processing, providing more sophisticated post-translational modifications while still offering reasonable yields for research purposes . Mammalian cell expression, though typically more expensive and lower-yielding, provides the most authentic post-translational modifications and is often preferred for functional studies where protein activity is paramount .

Purification Techniques

Purification of Recombinant Pan troglodytes TSPAN7 employs multiple chromatographic techniques to isolate the target protein from cellular components and contaminants. Affinity chromatography represents the cornerstone of purification strategies when the recombinant protein incorporates affinity tags such as His-tag, allowing for specific binding to complementary ligands immobilized on chromatography columns . Following initial capture, additional purification steps may include ion exchange chromatography, size exclusion chromatography, or hydrophobic interaction chromatography to achieve the high purity levels required for research applications . The purification process must be carefully optimized to maintain protein stability and functionality while removing contaminants, with buffer conditions tailored to preserve the native structure of the tetraspanin protein . Quality control testing, including SDS-PAGE analysis, confirms that the final purified product meets or exceeds the specified purity target of 85%, ensuring reliability in downstream research applications .

Comparative Analysis with Human TSPAN7

Understanding the relationship between Pan troglodytes TSPAN7 and its human counterpart provides valuable insights into the evolutionary conservation of this protein's structure and function. Human TSPAN7, also known as TALLA-1, shares significant sequence homology with the Pan troglodytes version, reflecting the close evolutionary relationship between these species . The human version has been extensively studied due to its association with X-linked mental retardation and various neuropsychiatric conditions, suggesting important roles in neurological development and function . Both human and Pan troglodytes TSPAN7 function as cell surface glycoproteins, participating in complex formation with integrins and potentially influencing cellular processes such as adhesion, migration, and signaling . The recombinant Pan troglodytes protein serves as an excellent model for comparative studies, enabling researchers to investigate the conservation of functional domains and interaction partners across these closely related primate species.

Functional Comparison

The functional profiles of Pan troglodytes and human TSPAN7 exhibit notable similarities, reflecting their close evolutionary relationship. Human TSPAN7 is known to play roles in neurite outgrowth and neuronal development, with mutations associated with cognitive impairments and X-linked mental retardation . While specific functional data for the Pan troglodytes version is more limited, the conservation of protein structure suggests similar neurological roles that may be investigated using the recombinant protein . Both proteins form complexes with integrins and other membrane components, participating in the organization of functional microdomains at the cell surface that influence cellular behavior and signaling processes . Recent research has also highlighted potential roles for TSPAN7 in tumor progression, with studies in human kidney neoplasms revealing correlations between TSPAN7 expression and patient survival that may have parallels in other primates .

Research Applications

Recombinant Pan troglodytes TSPAN7 serves as a valuable tool across multiple research disciplines, enabling investigations that would be challenging or impossible with naturally occurring proteins. The recombinant protein facilitates detailed structural analyses using techniques such as X-ray crystallography, nuclear magnetic resonance spectroscopy, and cryo-electron microscopy, contributing to our understanding of tetraspanin architecture . In functional studies, the recombinant protein can be used to investigate protein-protein interactions, particularly with integrin partners that form functional complexes at the cell surface . The protein also serves as an important reagent for generating specific antibodies that enable detection and localization studies in both research and potential diagnostic applications . Evolutionary biology research benefits from comparative analyses between Pan troglodytes and human TSPAN7, providing insights into the conservation and divergence of protein function across primate species .

Neuroscience Research

The potential neurological functions of TSPAN7 make the recombinant Pan troglodytes version particularly valuable in neuroscience research. Human TSPAN7 has established associations with X-linked mental retardation and neuropsychiatric conditions, suggesting important roles in neuronal development and function that may be conserved in chimpanzees . The recombinant protein enables comparative studies to investigate these neurological functions across primate species, potentially revealing both conserved mechanisms and species-specific adaptations . Researchers can use the recombinant protein to study interactions with neuronal proteins, examine effects on neurite outgrowth, and investigate signaling pathways that influence neuronal development and plasticity . These studies contribute to our understanding of the molecular basis of neurological disorders and may identify novel therapeutic targets for conditions associated with TSPAN7 dysfunction in humans.

Cancer Research

Recent findings highlighting TSPAN7's potential role in tumor progression underscore the value of recombinant versions in cancer research. Studies have identified correlations between TSPAN7 expression and survival in patients with kidney neoplasms, suggesting potential roles in cancer development or progression that may be investigated using the recombinant protein . The protein enables researchers to study interactions with cancer-associated proteins, examine effects on cell proliferation and migration, and investigate signaling pathways that may contribute to malignant transformation . Comparative oncology studies utilizing both human and Pan troglodytes TSPAN7 may reveal conserved mechanisms of cancer-related processes across primate species, potentially identifying novel biomarkers or therapeutic targets . The recombinant protein thus represents an important tool for advancing our understanding of TSPAN7's roles in normal cellular function and disease states, particularly in the context of cancer biology.

Future Research Directions

The continued study of Recombinant Pan troglodytes TSPAN7 promises to advance our understanding of tetraspanin biology and its implications for human health and disease. Future research directions may include more detailed structural characterization using advanced techniques such as cryo-electron microscopy, potentially revealing fine structural differences between Pan troglodytes and human versions that influence function . Expanded functional studies investigating protein-protein interaction networks, particularly with integrin partners and signaling molecules, will enhance our understanding of TSPAN7's role in cellular processes across primate species . The potential association with tumor progression suggests valuable opportunities for cancer research, with studies examining TSPAN7's influence on cancer cell behavior potentially identifying novel therapeutic targets . Advanced genetic studies comparing TSPAN7 across primate species may provide evolutionary insights while potentially revealing sequence variations that influence function or disease susceptibility in humans .

Therapeutic Applications

The development of therapeutic applications represents a promising frontier for research involving Recombinant Pan troglodytes TSPAN7. Understanding structural and functional similarities between Pan troglodytes and human TSPAN7 could inform the development of targeted therapies for conditions associated with TSPAN7 dysfunction, particularly neurological disorders linked to mutations in this gene . The recombinant protein enables screening of small molecule libraries to identify compounds that modulate TSPAN7 activity, potentially leading to novel therapeutic agents for these conditions . The protein's potential role in cancer progression suggests opportunities for developing diagnostic markers or therapeutic targets based on TSPAN7 expression or activity patterns . Comparative studies across species may reveal conserved interaction sites or functional domains that represent promising targets for therapeutic intervention, potentially leading to new treatment strategies for conditions ranging from neurodevelopmental disorders to certain forms of cancer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
TSPAN7; TM4SF2; Tetraspanin-7; Tspan-7; Transmembrane 4 superfamily member 2; CD antigen CD231
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
TSPAN7
Target Protein Sequence
METKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGT GTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYT DAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQD LHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQ YEMV
Uniprot No.

Target Background

Function
Tetraspanin-7 (TSPAN7) may play a role in cell proliferation and cell motility.
Database Links

KEGG: ptr:450182

STRING: 9598.ENSPTRP00000037400

UniGene: Ptr.203

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional characterization of TSPAN7?

TSPAN7 belongs to the transmembrane 4 superfamily (tetraspanin family), characterized by four hydrophobic transmembrane domains. Most members of this family are cell-surface proteins that function in signal transduction pathways . TSPAN7 functions as a cell surface glycoprotein that forms complexes with integrins and may play a crucial role in controlling neurite outgrowth .

The protein consists of:

  • Four transmembrane domains

  • Two extracellular loops with conserved cysteine residues

  • Short intracellular N- and C-terminal domains

Human recombinant TSPAN7 segments (such as Arg113-Met213) have a molecular mass of approximately 12.6-13.63 kDa, which may appear as 13.5-18 kDa on SDS-PAGE under reducing conditions when expressed with a His tag .

How does Pan troglodytes TSPAN7 compare to human TSPAN7?

While the search results primarily focus on human TSPAN7, researchers should be aware of the important comparative aspects when working with Pan troglodytes (chimpanzee) TSPAN7:

  • Sequence homology: Due to the high genetic similarity between humans and chimpanzees (98-99%), TSPAN7 likely shares significant sequence conservation, particularly in functional domains.

  • Experimental considerations:

    • Antibody cross-reactivity should be validated when using human-targeted antibodies for chimpanzee TSPAN7

    • Species-specific post-translational modifications may affect protein function

    • Binding partners may have subtle differences affecting interaction strength or specificity

  • Comparative analysis approach:

    • Sequence alignment to identify conserved versus divergent regions

    • Functional assays comparing binding properties and signaling outcomes

    • Expression pattern analysis across tissues in both species

What are the primary biological roles of TSPAN7?

TSPAN7 has several important biological functions that make it a significant research target:

  • Neurological function:

    • Associated with X-linked mental retardation and neuropsychiatric diseases including Huntington's chorea, fragile X syndrome, and myotonic dystrophy

    • Plays a role in neurite outgrowth, suggesting importance in neuronal development

  • Signal transduction:

    • Mediates signaling events that regulate cell development, activation, growth, and motility

    • Forms complexes with integrins, potentially affecting cell adhesion and migration

  • Cancer biology:

    • Decreases in high-grade gliomas, with low expression associated with poor prognosis

    • May function as a tumor suppressor by inhibiting glioma progression

  • Immune function:

    • Recently identified as a key immune system target in type 1 diabetes

    • May have unexplored roles in immune cell function and regulation

What are optimal methods for detecting TSPAN7 expression in tissue samples?

Multiple complementary approaches can be employed for reliable TSPAN7 detection:

  • Quantitative Real-Time PCR (qRT-PCR):

    • RNA extraction method: TRIzol-based extraction followed by RNA extraction kit

    • Example primer sequences (human TSPAN7):

      • Forward: 5'-STATCCTTCGTCTTCGGATC-3'

      • Reverse: 5'-CATACAGTTTCAGCATCGG-3'

    • PCR conditions: 95°C for 15 min, followed by 40 cycles of 95°C for 15s and 60°C for 1 min

    • Analysis: Dissolution curve analysis to confirm primer specificity

  • Western Blotting:

    • Protein extraction: RIPA lysate with BCA method for concentration determination

    • Electrophoresis: 12% SDS-PAGE at 80V until the minimum molecular weight marker reaches the bottom

    • Transfer conditions: 200mA constant current for 80 minutes to PVDF membrane

    • Detection: Commercial antibodies such as TSPAN7 (abcam, ab211870) have been validated

    • Quantification: ImageJ software for band intensity analysis

  • Immunofluorescence/Immunohistochemistry:

    • Fixation: Optimize protocols for membrane proteins to maintain epitope accessibility

    • Controls: Include normal brain tissue as positive control

    • Counterstaining: Nuclear stains to visualize cellular context

What are the production and purification strategies for recombinant TSPAN7?

Production of high-quality recombinant TSPAN7 can be achieved through several expression systems:

  • E. coli Expression System:

    • Successfully used for human TSPAN7 (Arg113-Met213) with His tag

    • Advantages: High yield, cost-effective, scalable production

    • Limitations: Lack of post-translational modifications, potential folding issues with membrane proteins

  • Insect Cell Expression System:

    • Sf9 insect cells have been effectively used for TSPAN7 production

    • Produces glycosylated polypeptide chain with proper folding

    • More suitable for producing proteins requiring post-translational modifications

  • Purification Protocol:

    • Affinity chromatography using His-tag (for His-tagged constructs)

    • Proprietary chromatographic techniques for further purification

    • Quality control by SDS-PAGE (>90% purity achievable)

  • Protein Characteristics:

    PropertySpecification
    Molecular Mass12.6-13.63 kDa (13.5-18 kDa on SDS-PAGE)
    FormLyophilized powder or frozen liquid
    Purity>90% as determined by SDS-PAGE
    ConcentrationTypically 0.5mg/ml

What are critical considerations for experimental design using recombinant TSPAN7?

When designing experiments with recombinant TSPAN7, researchers should address several key considerations:

  • Protein stability and storage:

    • Short-term storage (2-4 weeks): 2-8°C

    • Long-term storage: -20°C to -80°C

    • Avoid repeated freeze-thaw cycles

    • For enhanced stability, add carrier protein (0.1% HSA or BSA)

    • Reconstitute lyophilized protein in sterile water

  • Functional validation approaches:

    • Binding assays with known interaction partners (e.g., integrins)

    • Cell-based functional assays (neurite outgrowth, migration)

    • Signaling pathway activation analysis (MAPK pathway)

  • Controls and standardization:

    • Include both positive controls (normal brain tissue)

    • Use empty vector controls for overexpression studies

    • Monitor transfection efficiency with fluorescent reporters

    • Employ multiple housekeeping genes/proteins for normalization

  • Species considerations:

    • Validate antibody cross-reactivity between human and Pan troglodytes TSPAN7

    • Consider potential functional differences when extrapolating across species

How does TSPAN7 influence neurological function and disorders?

TSPAN7 has significant implications for neurological development and disease:

  • Genetic associations:

    • The TSPAN7 gene is associated with X-linked mental retardation (MRX58)

    • Also linked to neuropsychiatric diseases including Huntington's chorea, fragile X syndrome, and myotonic dystrophy

  • Neuronal development:

    • May play a crucial role in neurite outgrowth regulation

    • Forms complexes with integrins that potentially influence neuronal migration and adhesion

  • Research approaches:

    • Lentiviral overexpression systems to study TSPAN7 function in neuronal cells

    • TSPAN7 knockout/knockdown models to examine loss-of-function effects

    • Protein-protein interaction studies to identify neuronal binding partners

    • Signaling pathway analysis focusing on neuronal differentiation and migration

  • Therapeutic implications:

    • Potential target for interventions in neurodevelopmental disorders

    • Modulation of TSPAN7-integrin interactions might influence neuronal connectivity

    • Expression restoration strategies could address TSPAN7 deficiency in genetic disorders

What is the significance of TSPAN7 in cancer biology, particularly gliomas?

Research has revealed important associations between TSPAN7 and cancer progression:

  • Expression pattern in gliomas:

    • TSPAN7 expression decreases in high-grade gliomas compared to normal brain tissue

    • Low expression correlates with poor prognosis across multiple datasets

  • Prognostic value:

    • Multivariate COX regression analysis identified TSPAN7 as an independent prognostic factor:

      • TCGA dataset: HR = 0.65, p < 0.05

      • CGGA_325 dataset: HR = 0.38, p < 0.001

      • CGGA_693 dataset: HR = 0.58, p < 0.01

  • Tumor suppressor function:

    • High TSPAN7 expression appears to inhibit glioma progression

    • As TSPAN7 expression decreases, tumors show more aggressive biological behaviors

  • Affected pathways:

    • Low TSPAN7 expression correlates with increased activity in:

      • Cell proliferation pathways

      • Epithelial-mesenchymal transition (EMT)

      • Angiogenesis

      • DNA repair mechanisms

      • MAPK signaling

How does TSPAN7 interact with cellular signaling networks?

TSPAN7's involvement in signal transduction networks is multifaceted:

  • Integrin complexes:

    • TSPAN7 forms complexes with integrins at the cell surface

    • These interactions likely occur within tetraspanin-enriched microdomains (TEMs)

    • Complexes may influence cell adhesion, migration, and signaling

  • Signal transduction pathways:

    • Mediates signaling events regulating cell development, activation, growth, and motility

    • Inverse relationship with MAPK pathway activation - lower TSPAN7 correlates with increased MAPK signaling

  • Cellular process regulation:

    • Influences multiple processes through these signaling interactions:

      • Cell proliferation capacity

      • Epithelial-mesenchymal transition

      • Angiogenesis

      • DNA repair mechanisms

  • Research methodologies:

    • Co-immunoprecipitation to identify binding partners

    • Phosphorylation analysis of downstream signaling components

    • Transcriptional profiling to identify regulated gene networks

    • Functional assays measuring cellular responses to TSPAN7 modulation

What are common challenges when working with recombinant TSPAN7?

Researchers should anticipate and address several technical challenges:

  • Protein solubility and aggregation:

    • As a membrane protein, TSPAN7 contains hydrophobic domains prone to aggregation

    • Solution: Use appropriate buffers like PBS with 10% glycerol

    • Consider mild detergents for maintaining solubility

  • Maintaining native conformation:

    • Extracellular domains with disulfide bonds require proper oxidizing conditions

    • Expression system selection influences proper folding and post-translational modifications

    • Consider non-reducing conditions during purification and analysis

  • Tag interference:

    • Common His-tag may affect protein function in some assays

    • Evaluate tag position (N- vs C-terminal) for optimal protein function

    • Consider tag removal for critical functional studies

  • Storage stability:

    • Avoid repeated freeze-thaw cycles that reduce activity

    • Aliquot purified protein to minimize freezing/thawing

    • Add carrier proteins (0.1% HSA or BSA) for long-term storage

  • Reconstitution issues:

    • For lyophilized proteins, ensure complete dissolution

    • Use gentle mixing rather than vortexing

    • Allow sufficient time for complete rehydration

How can researchers validate functional activity of recombinant TSPAN7?

Multiple approaches ensure recombinant TSPAN7 maintains its biological activity:

  • Structural validation:

    • Circular dichroism spectroscopy for secondary structure confirmation

    • Size exclusion chromatography to assess oligomeric state

    • Limited proteolysis to verify proper folding

  • Binding assays:

    • Co-immunoprecipitation with known binding partners (integrins)

    • Surface plasmon resonance for interaction kinetics

    • Pull-down assays with cellular extracts to identify binding partners

  • Functional assays:

    • Neurite outgrowth assays in neuronal cell models

    • Cell migration/invasion studies

    • Signaling pathway activation, particularly MAPK pathway components

  • Comparison with overexpression studies:

    • Lentiviral overexpression systems as positive controls

    • Compare cellular effects of recombinant protein to genetic overexpression

    • Evaluate cellular localization patterns

What essential controls should be included in TSPAN7 studies?

Rigorous controls are critical for reliable TSPAN7 research:

  • For gene expression studies (qRT-PCR):

    • Multiple reference genes for normalization

    • No-template controls to detect contamination

    • No-RT controls to detect genomic DNA

    • Primer specificity verification via melt curve analysis

  • For protein expression studies (Western blot):

    • Loading controls (GAPDH, β-actin)

    • Positive controls (normal brain tissue)

    • Negative controls (tissues known not to express TSPAN7)

    • Antibody specificity controls

  • For functional studies:

    • Empty vector controls for overexpression experiments

    • Fluorescent reporter monitoring for transfection efficiency

    • Dose-response experiments to establish working concentrations

    • Pathway inhibitors to confirm mechanism specificity

  • For clinical sample analysis:

    • Matched normal adjacent tissue controls

    • Grade/stage-matched controls

    • Demographic-matched controls

What emerging roles of TSPAN7 in immune function merit investigation?

Recent findings suggest promising directions for TSPAN7 immunology research:

  • Type 1 diabetes connection:

    • TSPAN7 has been identified as a key immune system target in type 1 diabetes

    • Potential autoimmune recognition mechanisms require investigation

    • Implications for other autoimmune conditions

  • Immune cell expression and function:

    • Expression patterns across immune cell populations

    • Potential roles in immune cell activation, migration, and effector functions

    • Involvement in antigen presentation or immune synapse formation

  • Inflammatory pathway interaction:

    • Relationship between TSPAN7 and inflammatory signaling pathways

    • Cross-talk with cytokine receptors and inflammatory mediators

    • Effects on transcriptional regulation of inflammatory responses

  • Neuroinflammation:

    • Given TSPAN7's brain expression and neurological associations , its role in neuroinflammatory processes

    • Potential involvement in microglial or astrocyte responses

    • Implications for neurodegenerative disease mechanisms

How might TSPAN7-targeted approaches advance therapeutic development?

TSPAN7's roles in neurological disorders and cancer suggest therapeutic potential:

  • Neurological applications:

    • Gene therapy approaches for X-linked mental retardation

    • Small molecule modulators enhancing TSPAN7 function

    • Targeting TSPAN7-integrin interactions to influence neuronal development

  • Oncological approaches:

    • TSPAN7 restoration strategies for gliomas

    • Development as a prognostic biomarker for treatment stratification

    • Targeting downstream pathways affected by TSPAN7 loss

  • Technical challenges:

    • Blood-brain barrier penetration for CNS-targeted therapies

    • Cell-type specific delivery strategies

    • Maintaining functional protein conformation in therapeutic formulations

  • Combination approaches:

    • Integration with existing treatment modalities

    • Potential synergy with immunotherapies given emerging immune functions

    • Multi-targeted approaches addressing TSPAN7-related pathways

What knowledge gaps exist in cross-species TSPAN7 research?

Critical areas for further investigation include:

  • Comparative genomics and proteomics:

    • Systematic comparison of TSPAN7 across primates and mammals

    • Identification of conserved functional domains versus species-specific adaptations

    • Examination of regulatory mechanisms controlling expression

  • Functional conservation assessment:

    • Whether TSPAN7's roles in neurite outgrowth and signaling are conserved across species

    • Comparative analysis of binding partners and interaction networks

    • Species-specific post-translational modifications and their functional implications

  • Pan troglodytes TSPAN7 characterization:

    • Comprehensive tissue expression profiling

    • Direct biochemical and functional comparison with human TSPAN7

    • Identification of any functional differences informing human-specific traits

  • Evolutionary perspectives:

    • Analysis of selective pressures on TSPAN7 throughout primate evolution

    • Correlation with emergence of advanced cognitive functions

    • Implications for understanding human-specific neurological disorders

  • Model system relevance:

    • Evaluation of how faithfully various model organisms recapitulate human TSPAN7 function

    • Development of appropriate models for studying TSPAN7-related disorders

    • Consideration of species-specific differences when interpreting experimental results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.