Recombinant Pan troglodytes Trace amine-associated receptor 1 (TAAR1)

Shipped with Ice Packs
In Stock

Description

Definition and Characteristics

Recombinant Pan troglodytes Trace amine-associated receptor 1 (TAAR1) is a genetically engineered protein derived from chimpanzee (Pan troglodytes) genomic sequences. It represents a homolog of the human TAAR1, a G protein-coupled receptor (GPCR) that modulates monoaminergic neurotransmission and immune responses . This recombinant variant is produced via heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) and is critical for structural, functional, and pharmacological studies .

Key characteristics include:

  • Genomic origin: Pan troglodytes (chimpanzee), Uniprot accession Q5QD29 .

  • Expression systems: Yeast, E. coli, Baculovirus, mammalian cells, or in vitro biotinylation in E. coli .

  • Post-translational modifications: Tags (e.g., His, SUMO, Avi, Fc) may be appended to enhance solubility and purification .

Functional Roles

TAAR1 regulates monoamine neurotransmission (dopamine, serotonin, norepinephrine) and immune responses. Recombinant Pan troglodytes TAAR1 is used to study:

  • Ligand binding: Species-specific interactions with trace amines (e.g., tyramine > β-PEA > dopamine) .

  • G protein signaling: Coupling to Gαs (cAMP production) and Gαq (Ca²⁺ mobilization) .

  • Drug development: Screening TAAR1 agonists (e.g., RO5203648) for schizophrenia and addiction .

Research Applications

Recombinant Pan troglodytes TAAR1 enables advanced biochemical and pharmacological assays:

Functional Assays

ApplicationExample Use CaseSource
ELISAQuantification of TAAR1 protein expression in recombinant systems.
Ligand bindingRadioligand assays to test affinity of synthetic agonists (e.g., S18616).
G protein activationMeasurement of cAMP production via fluorescence-based assays.

Immunological Studies

  • Leukocyte activation: TAAR1 agonists modulate T-cell differentiation and IgE secretion .

Challenges and Considerations

  • Expression challenges: Intracellular localization in native tissues requires optimized membrane targeting .

  • Species differences: Human TAAR1 has 83% similarity to rodent homologs, necessitating primate models for translational studies .

  • Genetic variants: Single nucleotide polymorphisms (e.g., D103N) may alter ligand binding or signaling efficiency .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specified tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
TAAR1; TRAR1; Trace amine-associated receptor 1; TaR-1; Trace amine receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKELHTPTNW LIHSMATVDFLPGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID RYYAVCDPLRYKAKINILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLINDANQKLQIGLEMKNG ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Uniprot No.

Target Background

Function
Trace amine-associated receptor 1 (TAAR1) is a receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine, and tryptamine. It exhibits the highest affinity for b-PEA and p-TYR. TAAR1 is unresponsive to classical biogenic amines such as epinephrine and histamine, and only partially activated by dopamine and serotonin. Trace amines are biogenic amines found in very low levels in mammalian tissues. While some trace amines have clearly defined roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. Trace amines are likely involved in various physiological functions that are not yet fully understood. The signal transduced by this receptor is mediated by the G(s)-class of G-proteins, which activate adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pan troglodytes TAAR1 and how does it differ from human TAAR1?

Pan troglodytes TAAR1 is a G protein-coupled receptor that responds to trace amines in chimpanzees. While functionally similar to human TAAR1, evolutionary analysis reveals species-specific adaptations. Unlike humans who maintain 6 functional TAAR genes (including TAAR1, TAAR2, TAAR5, TAAR6, TAAR8, and TAAR9), chimpanzees retain only 3 functional TAAR genes (TAAR1, TAAR5, and TAAR6) with 6 pseudogenes . This reduction suggests differential evolutionary pressure on olfactory and neurotransmitter systems between these closely related primates.

What ligands activate Pan troglodytes TAAR1 in experimental settings?

Pan troglodytes TAAR1 responds to various endogenous trace amines similar to its human ortholog, including β-phenylethylamine (PEA), tyramine (TYR), octopamine (OCT), synephrine (SYN), and tryptamine (TRYP) . Additionally, compounds containing a 2-carbon aliphatic side chain linking an amino group to at least one benzene ring can function as potent agonists, including amphetamine, methamphetamine, and dopamine . Experimental activation typically measures cAMP production via G protein signaling cascades.

What expression systems are most effective for studying recombinant Pan troglodytes TAAR1?

For functional studies of recombinant Pan troglodytes TAAR1, heterologous expression systems including Xenopus laevis oocytes and various eukaryotic cell lines (particularly HEK293 cells) have proven most effective . When properly expressed, the receptor demonstrates dose-dependent coupling to stimulation of cAMP production, making cAMP assays the primary readout for receptor activation and functional analysis in standard laboratory protocols.

How can researchers utilize Pan troglodytes TAAR1 to understand the evolution of neuropsychiatric disorder susceptibility?

Researchers can employ comparative genomics and molecular evolution approaches focusing on Pan troglodytes TAAR1 to understand primate-specific adaptations in neurotransmitter systems. Since the TAAR1 gene maps to chromosome 6q23.2 in humans, coinciding with susceptibility loci for schizophrenia and bipolar disorder , cross-species functional analyses of recombinant TAAR1 can reveal evolutionary constraints and adaptations relevant to neuropsychiatric vulnerability. Recommended methodology includes:

  • Parallel pharmacological profiling of human and chimpanzee TAAR1

  • Site-directed mutagenesis targeting divergent residues

  • Electrophysiological assessment of downstream signaling differences

  • Computational modeling of receptor-ligand interactions

These approaches can elucidate how evolutionary changes in TAAR1 structure might contribute to species-specific neuropsychiatric vulnerability profiles.

What methodological approaches best assess Pan troglodytes TAAR1 coupling to different G protein subtypes?

To comprehensively assess G protein coupling specificity of Pan troglodytes TAAR1:

  • BRET/FRET-based protein-protein interaction assays to monitor receptor-G protein association in real-time

  • [35S]GTPγS binding assays with immunoprecipitation of specific G protein subtypes

  • Pathway-specific reporter assays (e.g., CRE-luciferase for Gs, SRE-luciferase for Gq)

  • Cryo-EM structural studies of TAAR1-G protein complexes

Recent structural data reveals TAAR1 can couple to both Gs and Gq proteins, suggesting sophisticated signaling profiles that may differ between species . Careful optimization of these methodologies is essential when working with the chimpanzee variant to account for potential species-specific coupling efficiencies.

How do endogenous amine-containing metabolites (EAMs) differentially regulate Pan troglodytes TAAR1 compared to other primate TAAR1 orthologs?

Comparative pharmacological profiling requires:

  • Parallel dose-response curves for a panel of EAMs across primate TAAR1 orthologs

  • Measurement of multiple signaling outputs (cAMP, Ca2+, ERK phosphorylation)

  • Binding affinity determination through competitive displacement assays

  • Analysis of receptor internalization and desensitization kinetics

The primary amine recognition pocket (PARP) containing the conserved acidic D3.32 residue is crucial for ligand recognition . Species-specific variations in residues surrounding this pocket may contribute to subtle differences in ligand preference and signaling bias that can only be detected through rigorous comparative analysis.

What control conditions are essential when assessing Pan troglodytes TAAR1 signaling in heterologous expression systems?

Essential controls include:

  • Empty vector transfections to account for endogenous receptor activity

  • Expression-matched human TAAR1 for direct interspecies comparison

  • Constitutively active and inactive TAAR1 mutants as reference points

  • Measurements in the presence of monoamine oxidase inhibitors to prevent trace amine degradation

  • Verification of surface expression through immunocytochemistry or surface biotinylation

These controls help distinguish receptor-specific effects from artifacts and enable meaningful cross-species comparisons, particularly important given the differential pseudogenization observed across primate TAAR gene families .

How should researchers address the challenge of low surface expression when working with recombinant Pan troglodytes TAAR1?

Optimizing surface expression requires:

  • Codon optimization for the selected expression system

  • Co-expression with chaperone proteins (e.g., RAMPs, RTPs)

  • Addition of N-terminal signal sequences and/or C-terminal ER export motifs

  • Temperature manipulation during expression (typically 30°C versus 37°C)

  • Use of chemical chaperones like DMSO or glycerol in culture media

Additionally, creating chimeric constructs with the N-terminus of better-expressing GPCRs while maintaining the ligand-binding domains of Pan troglodytes TAAR1 can dramatically improve functional expression for challenging assays like electrophysiology or structural biology.

How does the functional profile of Pan troglodytes TAAR1 compare to other TAAR family members in primates?

The table below summarizes the evolutionary status of TAAR genes across selected primate species:

SpeciesTotal TAAR genes (pseudogenes)TAAR1TAAR2TAAR3TAAR4TAAR5TAAR6TAAR7TAAR8TAAR9
Human6 (3)FFPPFFPFF
Chimpanzee3 (6)FPPPFFPPP
Bonobo2 (7)FPPPFPPPP
Gorilla3 (6)FFPPFPPPP

F = Functional gene, P = Pseudogene

This pattern of pseudogenization suggests selective functional preservation of TAAR1 across primates, highlighting its likely fundamental physiological importance compared to other family members. Methodologically, researchers should consider this evolutionary context when designing comparative studies, particularly focusing on conserved versus divergent signaling pathways among the maintained functional receptors.

What structural features differentiate Pan troglodytes TAAR1 in ligand recognition compared to other G protein-coupled receptors?

Pan troglodytes TAAR1, like human TAAR1, possesses a characteristic primary amine recognition pocket (PARP) featuring a conserved acidic D3.32 residue critical for amine recognition . When designing experiments to probe structure-function relationships:

  • Focus mutagenesis studies on residues within the binding pocket that differ between species

  • Employ molecular dynamics simulations to predict ligand binding modes

  • Conduct cross-species pharmacological profiling with structurally diverse ligands

  • Compare crystal or cryo-EM structures when available

These approaches help delineate how subtle species-specific structural variations influence ligand selectivity, efficacy, and signaling bias across different primate TAAR1 orthologs.

How can researchers overcome the challenge of trace amine instability in experimental systems?

Trace amines are rapidly metabolized by monoamine oxidase (MAO), presenting challenges for consistent experimental results. Methodological solutions include:

  • Addition of MAO inhibitors (e.g., pargyline or clorgyline) to experimental buffers

  • Preparation of fresh ligand solutions immediately before experiments

  • Time-course measurements to account for degradation kinetics

  • Use of metabolically stable synthetic analogues as reference compounds

  • Storage of stock solutions under argon or nitrogen atmosphere at -80°C

These practical considerations are essential for generating reproducible data when working with the natural ligands of Pan troglodytes TAAR1 in diverse experimental contexts.

What are the best approaches for validating antibody specificity when detecting Pan troglodytes TAAR1 expression?

Due to high sequence homology between primate TAAR1 proteins and potential cross-reactivity with other aminergic receptors, rigorous validation is essential:

  • Always include parallel analysis of TAAR1-knockout or TAAR1-negative cells

  • Perform peptide competition assays to confirm epitope specificity

  • Validate antibody recognition using recombinant TAAR1 proteins from multiple species

  • Compare multiple antibodies targeting different TAAR1 epitopes

  • Complement immunodetection with mRNA quantification methods

When possible, epitope tagging (HA, FLAG, etc.) of recombinant Pan troglodytes TAAR1 offers an alternative approach that circumvents antibody specificity issues for initial characterization studies.

How might Pan troglodytes TAAR1 research inform therapeutic development for neuropsychiatric disorders?

Comparative studies of Pan troglodytes and human TAAR1 can uniquely inform drug development through:

  • Identification of conserved binding pocket features for designing metabolically stable agonists

  • Understanding species-specific side effect profiles to predict human tolerability

  • Elucidating evolutionary constraints on TAAR1 signaling relevant to therapeutic efficacy

  • Developing chimeric receptors or transgenic models for preclinical evaluation

What emerging technologies will advance Pan troglodytes TAAR1 research?

Several cutting-edge methodologies show particular promise:

  • Cryo-EM for determining TAAR1-ligand-G protein complex structures at atomic resolution

  • CRISPR-based genome editing to create isogenic cell lines with species-specific TAAR1 variants

  • Single-cell transcriptomics to map cell type-specific TAAR1 expression in primate brain tissues

  • Optical biosensors for real-time monitoring of TAAR1 signaling in live cells

  • Machine learning approaches to predict species-specific pharmacological profiles

These technologies will enable researchers to address fundamental questions about the evolutionary and functional significance of TAAR1 across primates with unprecedented precision and detail.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.