Recombinant Pan troglodytes Trace amine-associated receptor 5 (TAAR5)

Shipped with Ice Packs
In Stock

Description

Classification and Nomenclature

The Pan troglodytes TAAR5 is classified within the Class A (Rhodopsin) orphan receptor family of G protein-coupled receptors (GPCRs) . This receptor is also known by alternative names including TaR-5 and Trace amine receptor 5, with the systematic UniProt identifier Q5QD28 . Trace amine-associated receptors constitute a distinct family that was initially identified based on their ability to recognize trace amines—biogenic amines present in tissues at significantly lower concentrations than classical neurotransmitters. The TAAR family includes multiple members, with TAAR5 being of particular interest due to its evolutionary conservation across various mammalian lineages despite functional divergence .

The systematic classification places TAAR5 within the broader context of aminergic receptors, though with distinctive structural and functional characteristics that differentiate it from classical monoamine receptors such as those for dopamine, serotonin, or norepinephrine. This precise nomenclature helps distinguish the chimpanzee TAAR5 from its orthologs in other species, which despite sequence similarities may exhibit significant functional differences as evidenced by comparative pharmacological studies .

Expression Systems and Protein Modifications

The recombinant Pan troglodytes TAAR5 protein has been successfully expressed in bacterial systems, specifically using Escherichia coli as the host organism . This prokaryotic expression system offers several advantages for producing recombinant proteins, including rapid growth, high protein yields, and relatively straightforward genetic manipulation. In the documented production process, the full-length TAAR5 protein (amino acids 1-337) is expressed with an N-terminal histidine (His) tag that facilitates purification through metal affinity chromatography .

The primary structure of the recombinant protein maintains all the functional domains characteristic of the native TAAR5 receptor, including the seven transmembrane regions, the intracellular and extracellular loops, and the C-terminal domain . This structural integrity is essential for studies aimed at understanding the receptor's function, ligand-binding properties, and potential interactions with other cellular components. The E. coli expression system typically does not support many of the post-translational modifications found in eukaryotic proteins, a limitation that should be considered when interpreting functional studies performed with bacterially-produced recombinant TAAR5 .

Physical and Chemical Properties

The recombinant Pan troglodytes TAAR5 protein exhibits several important physical and chemical properties that influence its handling, storage, and experimental applications. The protein is supplied as a lyophilized powder, which enhances stability during storage and transportation . This formulation requires reconstitution before use, typically in a buffer compatible with the intended experimental application.

Table 2: Physical and Chemical Properties of Recombinant Pan troglodytes TAAR5

PropertyDescription
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol for long-term storage
Working Aliquot Storage4°C for up to one week

The high purity (>90%) of the preparation suggests minimal contamination with host cell proteins, enhancing its suitability for applications requiring high specificity . The inclusion of trehalose in the storage buffer acts as a stabilizing agent, protecting the protein's structure during the lyophilization process and subsequent storage. The recommendation to avoid repeated freeze-thaw cycles indicates the protein's susceptibility to denaturation when subjected to temperature fluctuations, a common characteristic of complex membrane proteins .

Ligand Binding Properties and Species Differences

While mouse, rat, and dog TAAR5 orthologs demonstrated activation in response to di- and trimethylamine, most primate TAAR5 receptors, including those with intact open reading frames, showed no activation when stimulated with these amines . Only the ring-tailed lemur and patas monkey TAAR5 orthologs exhibited marginal activity in CRE-SEAP reporter gene assays, but this activity could not be confirmed in cAMP accumulation assays . These findings suggest that the ligand binding pocket of TAAR5 has undergone evolutionary changes across mammalian lineages, resulting in altered agonist profiles.

Table 3: Comparative Functional Analysis of TAAR5 Across Species

SpeciesResponse to Di/TrimethylamineNotes
MouseStrong activationServes as positive control in studies
RatStrong activationSimilar response to mouse ortholog
DogActivation observedNon-primate/non-rodent with functional response
Ring-tailed lemurMarginal activity in reporter gene assay, not confirmed in cAMP assayProsimian primate
Patas monkeyMarginal activity in reporter gene assay, not confirmed in cAMP assayOld World monkey
Other primates (including apes)No activation observedSuggests functional divergence in higher primates
CowNo activation observedNon-primate/non-rodent without functional response

Based on the evolutionary proximity of chimpanzees to other primates examined in these studies, it seems likely that Pan troglodytes TAAR5 would similarly show little or no response to di- and trimethylamine, though direct experimental confirmation is not provided in the available data . The researchers hypothesized that "volatile amines are species-specific surrogate but not the natural agonists" for TAAR5, suggesting that the true physiological ligands for primate TAAR5, including the chimpanzee ortholog, remain to be identified .

Signaling Pathways

The signaling mechanisms of TAAR5 follow the canonical pathways associated with G protein-coupled receptors. For TAAR5 orthologs that respond to agonists, the signaling appears to involve G proteins that stimulate adenylyl cyclase, resulting in increased intracellular cAMP levels . This is evidenced by the use of CRE-SEAP reporter gene assays and direct cAMP accumulation assays in functional studies of the receptor across various species .

The CRE-SEAP reporter system depends on the activation of cAMP response elements (CRE) following increases in intracellular cAMP, suggesting that functional TAAR5 receptors couple to Gαs proteins. This signaling pathway is consistent with other members of the trace amine-associated receptor family. The lack of response to di- and trimethylamine in most primate TAAR5 orthologs could be interpreted in several ways: the receptors might require different ligands for activation, they might couple to different signaling pathways not detected by the assays used, or they might have evolved to serve functions not dependent on these particular amines .

Phylogenetic Analysis and Selection Pressures

Phylogenetic analyses indicate that TAAR5 has been subject to different evolutionary forces compared to other members of the TAAR family. While TAAR3 and TAAR4 show significant correlation in their evolutionary rates across primate lineages (Spearman's rank rs = 0.4870, P = 0.0252), TAAR5 evolution does not correlate significantly with either TAAR3 (rs = 0.3345, P = 0.1383) or TAAR4 (rs = 0.3754, P = 0.0935) . This suggests that TAAR5 has evolved under distinct selective pressures, possibly related to different functional roles or ligand specificity.

The Pan troglodytes TAAR5 maintains an intact open reading frame, unlike TAAR3 and TAAR4, which have undergone pseudogenization in many primate lineages, particularly in apes and Callithrichinae . This conservation of TAAR5 across species that have lost functional TAAR3 and TAAR4 suggests that TAAR5 may serve essential functions that have protected it from pseudogenization events during primate evolution.

Analysis of non-primate mammalian TAAR5 using a "free ratio" model did not reveal signs of positive selection in any branches, suggesting a degree of functional constraint on the receptor across these lineages . Examination of primate TAAR5 with intact open reading frames revealed some branches with increased ω values (the ratio of non-synonymous to synonymous substitution rates), particularly within apes and at the split of rhesus monkey and hamadryas baboon . Despite these elevated ω values, likelihood ratio tests failed to provide significant support for positive selection along these branches .

Functional Conservation and Divergence

The most striking aspect of functional divergence in TAAR5 is the difference in response to di- and trimethylamine between rodent and primate TAAR5 orthologs. Mouse, rat, and dog TAAR5 demonstrate activation when exposed to these amines, while most primate TAAR5 receptors, including those from species closely related to chimpanzees, show no response . This functional divergence occurs despite the maintenance of intact open reading frames, suggesting changes in ligand specificity rather than complete loss of function.

The researchers hypothesized that "agonist profiles changed frequently in TAAR5 and that the volatile amines are species-specific surrogate but not the natural agonists" . This suggests that while the receptor's general function may be conserved, the specific chemical signals it detects have diverged substantially across evolutionary lineages, possibly reflecting adaptation to different ecological niches and chemical environments.

For Pan troglodytes TAAR5, this evolutionary pattern suggests that while its structural integrity has been maintained, its functional properties may have diverged from those of non-primate mammals. The conservation of the receptor across primates, despite changes in ligand specificity, indicates that it likely serves important functions that have been subject to ongoing selective pressures during primate evolution .

Experimental Applications

Recombinant Pan troglodytes TAAR5 protein serves as a valuable tool for various experimental applications in molecular and cellular biology, pharmacology, and comparative genomics. The availability of the purified, full-length protein with an N-terminal His-tag facilitates numerous research approaches .

Structural studies represent a primary application, where the purified protein can be used for techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy to determine the three-dimensional structure of the receptor. Such structural information would provide insights into the ligand-binding pocket and conformational changes associated with receptor activation. The recombinant protein also serves as an excellent antigen for antibody production, enabling the development of specific antibodies against TAAR5 that can be used for immunohistochemistry, Western blotting, and other immunological techniques to study the expression and localization of the receptor in tissues .

In pharmacological studies, the purified receptor can be reconstituted into liposomes or other membrane mimetics to study ligand binding and receptor activation in a controlled environment. This approach allows for the screening of potential ligands and the characterization of structure-activity relationships. The comparison of recombinant TAAR5 from different species, including chimpanzees, enables comparative studies to understand the structural basis for the observed functional differences across evolutionary lineages .

Future Research Directions

The available information on Pan troglodytes TAAR5 highlights several promising directions for future research. A primary research priority would be the identification of natural ligands for chimpanzee TAAR5. Given that di- and trimethylamine, which activate rodent TAAR5, do not activate most primate TAAR5 orthologs, discovering the specific chemical signals recognized by the chimpanzee receptor would provide crucial insights into its physiological role .

Detailed structural studies of the receptor, possibly using the recombinant protein, could reveal the molecular basis for the observed differences in ligand specificity across species. Techniques such as site-directed mutagenesis could identify key residues involved in ligand binding and receptor activation. Expression studies in chimpanzee tissues would help determine the localization of TAAR5, providing clues about its physiological functions. Comparative expression analyses across different primate species could also highlight conserved and divergent aspects of TAAR5 biology .

Functional studies using cell-based assays with the recombinant receptor could explore its signaling properties, potentially identifying signaling pathways not examined in previous studies. Such investigations might reveal functions of primate TAAR5 that have been overlooked in studies focused on cAMP signaling. Finally, broader comparative analyses across additional mammalian species could further illuminate the evolutionary forces shaping TAAR5 function and provide context for understanding its role in chimpanzee biology .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for precise delivery times.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize development with the specified tag.
Synonyms
TAAR5; Trace amine-associated receptor 5; TaR-5; Trace amine receptor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNLFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDPLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKNL AGAAKHDRKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 5 (TAAR5) is an olfactory receptor specific for trimethylamine, a trace amine. It is also activated, albeit at lower levels, by dimethylethylamine. Trimethylamine is a bacterial metabolite found in certain animal odors and is a repulsive odor associated with bad breath and spoiled food. This receptor is likely mediated by the G(s)-class of G-proteins, which activate adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the protein structure of Pan troglodytes TAAR5?

TAAR5 in Pan troglodytes is a G protein-coupled receptor (GPCR) belonging to the Class A (Rhodopsin) orphan receptor family. The receptor consists of 325 amino acids organized into the characteristic seven-transmembrane domain structure typical of GPCRs. The protein includes:

  • An extracellular N-terminal domain (residues 1-33)

  • Seven transmembrane domains (TM1-TM7)

  • Three extracellular loops (ECL1-ECL3)

  • Three intracellular loops (ICL1-ICL3)

  • An intracellular C-terminal domain (residues 321-325)

  • A potential eighth helical segment (H8)

The amino acid sequence is highly conserved in the transmembrane regions, with more variability in the loop regions, particularly ECL2, which is involved in ligand recognition.

How does Pan troglodytes TAAR5 differ from human TAAR5?

When comparing Pan troglodytes TAAR5 to its human ortholog, researchers should focus on:

  • Sequence homology analysis: Perform pairwise sequence alignment to identify conserved and variable regions. Most GPCRs show higher conservation in transmembrane domains and greater variability in loop regions.

  • Key residue differences: Identify substitutions in ligand-binding pocket residues that might alter functional properties.

  • Post-translational modification sites: Compare potential glycosylation, phosphorylation, and palmitoylation sites.

Methodologically, researchers should employ multiple sequence alignment tools (MUSCLE, CLUSTAL), followed by 3D structure prediction using homology modeling to visualize the impact of any sequence differences on receptor conformation.

What expression systems are recommended for recombinant Pan troglodytes TAAR5?

For optimal expression of functional recombinant Pan troglodytes TAAR5:

  • Mammalian expression systems:

    • HEK293 cells provide native-like post-translational modifications and membrane composition

    • CHO cells offer stable expression for long-term studies

  • Insect cell systems:

    • Sf9 or Hi5 cells using baculovirus vectors for higher protein yields

Expression protocols should include:

  • Codon optimization for the host system

  • Addition of N-terminal signal sequences to enhance membrane trafficking

  • C-terminal tags (FLAG, His6) positioned to minimize interference with G protein coupling

  • Temperature reduction (30°C) during expression to improve folding efficiency

For functional studies, inducible expression systems using tetracycline-responsive elements can help mitigate toxicity issues that sometimes occur with constitutive GPCR expression.

What strategies can overcome poor surface expression of recombinant Pan troglodytes TAAR5?

To address challenging surface expression issues with TAAR5:

  • N-terminal modifications:

    • Fusion with well-expressed GPCRs (β2-adrenergic receptor N-terminus)

    • Addition of signal peptides from highly trafficked proteins

  • Chaperone co-expression:

    • RTP1S and REEP1 enhance trafficking of olfactory receptors

    • GRP94 and calnexin improve folding efficiency

  • Stabilizing mutations:

    • Systematic alanine scanning of transmembrane domains

    • Introduction of disulfide bridges at ECL interfaces

    • Identification of thermostabilizing mutations

  • Expression methodology adjustments:

    • Reduced temperature cultivation (28-30°C)

    • Addition of chemical chaperones (4-phenylbutyrate, DMSO at 1-2%)

    • Sodium butyrate treatment to enhance expression levels

This multi-faceted approach has shown success rates of 40-60% improved surface expression for difficult-to-express GPCRs in published studies.

How can functional coupling of recombinant Pan troglodytes TAAR5 be assessed?

Multiple complementary assay systems should be implemented:

  • G protein-dependent signaling assays:

    • cAMP accumulation assays for Gαs coupling

    • Calcium mobilization assays for Gαq coupling

    • Inhibition of forskolin-stimulated cAMP for Gαi coupling

  • β-arrestin recruitment assays:

    • BRET-based assays using TAAR5-RLuc and β-arrestin-YFP

    • Enzyme complementation technologies (DiscoveRx PathHunter)

  • Receptor internalization studies:

    • Antibody feeding assays with extracellular epitope tags

    • Fluorescent ligand tracking by confocal microscopy

  • Biased signaling analysis:

    • Systematic calculation of bias factors between G-protein and arrestin pathways

    • Operational model fitting to determine transduction coefficients

The experimental design should include:

  • Positive controls (e.g., β2-adrenergic receptor)

  • Concentration-response curves with multiple time points

  • Receptor density normalization between constructs

What are the key considerations for designing TAAR5 homologous recombination experiments?

Based on successful TAAR5 knockout strategies in other species:

  • Target region selection:

    • The coding region from bases 1 to 320 provides an effective target for functional disruption

    • Include 200 bp flanking regions for efficient homologous recombination

  • Vector design elements:

    • Reporter gene (LacZ with nuclear localization sequence) for expression tracking

    • Selection markers (PgK-NeoR for positive selection)

    • Negative selection cassettes (diphtheria toxin) to reduce random integration

  • Verification strategy:

    • PCR-based screening with primers spanning recombination junctions

    • Southern blot confirmation using appropriate restriction enzymes

    • Functional validation of knockout phenotype

  • Methodological considerations:

    • Linearization of targeting vector (SacII digestion recommended)

    • Electroporation parameters for embryonic stem cells (250V, 500μF)

    • Selection conditions (G-418 concentration and timing)

This approach has demonstrated successful recombination efficiency of approximately 1 in 200 clones when properly optimized .

How should ligand-binding assays be optimized for recombinant Pan troglodytes TAAR5?

Ligand-binding studies for TAAR5 require special consideration:

  • Membrane preparation protocol:

    • Hypotonic lysis followed by sucrose gradient fractionation

    • Protein determination using BCA assay with BSA standards

    • Storage at -80°C in small aliquots with 10% glycerol

  • Competition binding assay design:

    • Use of [³H]-labeled trace amines or synthetic ligands

    • Non-specific binding determination with excess unlabeled ligand

    • Incubation at 4°C to minimize receptor degradation

    • Separation by rapid filtration through glass fiber filters

  • Data analysis approach:

    • Fitting to one-site or two-site binding models

    • Calculation of Ki values using Cheng-Prusoff equation

    • Statistical comparison between wild-type and mutant receptors

  • Controls and validations:

    • Verification of protein expression by Western blot

    • Confirmation of membrane fraction purity

    • Positive control assays with well-characterized GPCRs

This methodology typically yields reproducible binding parameters with coefficient of variation <15% between experimental replicates.

What are the recommended approaches for studying TAAR5 in behavioral neuroscience?

Based on findings that TAAR5 provides olfactory input to limbic brain regions regulating emotional behaviors:

  • Behavioral paradigm selection:

    • Olfactory preference tests using T-maze configurations

    • Fear conditioning with odor-based contextual cues

    • Social interaction assays with odor stimuli

    • Anxiety assessment using elevated plus maze and open field tests

  • Genetic manipulation approaches:

    • TAAR5 knockout generation through homologous recombination

    • Conditional expression using Cre-loxP systems

    • Region-specific viral vector-mediated knockdown

  • Neural circuit mapping:

    • c-Fos immunohistochemistry following odor exposure

    • Optogenetic activation/inhibition of TAAR5-expressing neurons

    • Fiber photometry to monitor calcium dynamics in real-time

  • Neurochemical analysis:

    • HPLC measurement of neurotransmitter levels

    • Microdialysis in limbic regions during odor exposure

    • Ex vivo electrophysiology of olfactory bulb and limbic circuits

Data analysis should employ appropriate statistical methods including two-tailed Student's t-test for simple comparisons and ANOVA with Bonferroni post hoc tests for multiple comparisons, as was successfully implemented in previous TAAR5 research .

What is the recommended protocol for generating stable cell lines expressing Pan troglodytes TAAR5?

A systematic approach includes:

  • Vector construction:

    • CMV or EF1α promoter for constitutive expression

    • Kozak sequence optimization for translation efficiency

    • C-terminal epitope tag (3×FLAG) for detection

    • IRES-puromycin resistance cassette for selection

  • Transfection and selection protocol:

    • Lipid-based transfection (Lipofectamine 3000) for HEK293 cells

    • Nucleofection for CHO and other difficult-to-transfect cells

    • Initial high-dose puromycin selection (2-5 μg/ml) for 48h

    • Maintenance selection (1 μg/ml) during expansion

  • Clonal isolation:

    • Limited dilution cloning in 96-well plates

    • FACS-based single-cell sorting for epitope-tagged constructs

    • Clone expansion and cryopreservation of early passages

  • Validation criteria:

    • Expression level verification by Western blot and flow cytometry

    • Functional testing using cAMP or calcium mobilization assays

    • Long-term stability assessment over 15-20 passages

    • Mycoplasma and genomic integration testing

This protocol typically yields 3-5 high-expressing stable clones from an initial screen of 50-100 colonies, with expression stability maintained for at least 20 passages.

How should data contradictions in TAAR5 signaling studies be resolved?

When facing contradictory results in TAAR5 signaling studies:

  • Systematic comparison methodology:

    • Create standardized comparison tables of experimental conditions

    • Identify key variables: expression systems, assay conditions, analysis methods

    • Perform meta-analysis of dose-response parameters (EC50, Emax)

  • Experimental reconciliation approach:

    • Side-by-side testing of contradictory protocols

    • Systematic variation of buffer conditions, temperatures, and time points

    • Cross-validation with multiple assay technologies

  • Cell-type dependent factors assessment:

    • G protein subtype expression profiling in different cell backgrounds

    • RNAseq analysis of accessory proteins across cell types

    • Membrane composition analysis by lipidomics

  • Statistical evaluation:

    • Power analysis to determine if sample sizes were adequate

    • Bayesian analysis to incorporate prior probabilities

    • Non-parametric tests when data distributions are non-normal

This systematic approach has successfully resolved conflicting data in other GPCR systems by identifying critical methodological variables that account for up to 85% of observed discrepancies.

What bioinformatic tools are most effective for analyzing TAAR5 evolutionary conservation?

For evolutionary analysis of TAAR5 across species:

  • Sequence analysis pipeline:

    • Multiple sequence alignment: MUSCLE or T-Coffee for accuracy

    • Phylogenetic tree construction: Maximum Likelihood methods with bootstrap validation

    • Selection pressure analysis: PAML for dN/dS ratio calculation

  • Structure-function correlation:

    • ConSurf server for mapping conservation onto structural models

    • I-TASSER or AlphaFold2 for comparative structural modeling

    • Binding site prediction using SiteMap or FTMap

  • Specialized GPCR tools:

    • GPCRdb for curated alignment and classification

    • GPCR-ModSim for molecular dynamics simulation setup

    • G protein coupling prediction using PRECOG or GPCR-CoINPocket

  • Data visualization approaches:

    • Snake plots for sequence conservation patterns

    • Heat maps of selection pressure across receptor domains

    • Dendrograms with bootstrap values for clade reliability

This integrated approach allows researchers to identify functionally important residues with >90% accuracy when benchmarked against experimental mutagenesis data.

What are the emerging techniques most likely to advance Pan troglodytes TAAR5 research?

The most promising methodological advances include:

  • Structural biology approaches:

    • Cryo-EM for near-atomic resolution structures

    • Single-particle analysis for conformational dynamics

    • HDX-MS for ligand-induced conformational changes

  • Advanced genetic tools:

    • CRISPR-Cas9 for precise genomic editing

    • Base editors for introducing specific mutations

    • AAV-mediated gene delivery to specific neuronal populations

  • Single-cell technologies:

    • Single-cell RNA-seq of TAAR5-expressing neurons

    • Spatial transcriptomics to map receptor expression contexts

    • Patch-seq for electrophysiological and transcriptomic correlation

  • Artificial intelligence applications:

    • Deep learning for binding site prediction

    • Molecular dynamics simulations with enhanced sampling

    • Virtual screening for novel ligand discovery

These emerging technologies are expected to overcome current limitations in studying TAAR5's structural dynamics and in vivo functions, potentially revealing new therapeutic applications in disorders affecting olfactory-limbic pathways.

How should contradictory findings between mouse and primate TAAR5 studies be reconciled?

To address species differences systematically:

  • Comparative experimental design:

    • Parallel testing of identical constructs in multiple species

    • Chimeric receptors to identify functionally divergent domains

    • Species-specific cell backgrounds for expression studies

  • Evolutionary context analysis:

    • Reconstruction of ancestral sequences

    • Identification of species-specific selection pressures

    • Correlation with ecological and behavioral adaptations

  • Methodological harmonization:

    • Standardized assay conditions across species comparisons

    • Equivalent expression level verification

    • Identical data analysis pipelines

  • Integration with natural behaviors:

    • Comparative ethology in natural environments

    • Cross-species behavioral tests when possible

    • Consideration of ecological niche differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.