Recombinant Pan troglodytes Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Key Domains:

  • Extracellular N-terminal: Angiotensin II binding site.

  • Transmembrane helices: Signal transduction.

  • Intracellular C-terminal: G-protein coupling (Gq/11) .

Recombinant Production Methods

While no explicit data exists for recombinant Pan troglodytes AGTR1, production strategies mirror those for human AGTR1:

Expression Systems:

SystemAdvantagesExample (Human AGTR1)
E. coliCost-effective, high yieldRabbit AGTR1 (1-359aa, His tag)
HEK293Proper post-translational modificationsHuman AGTR1 (MBP/Flag tag)
Wheat germSoluble protein productionHuman AGTR1 (GST tag)

For chimpanzee AGTR1, codon-optimized synthetic genes would likely be cloned into vectors (e.g., pET, pcDNA3) and expressed in HEK293 or insect cells to ensure functional folding .

A. Hypertension and Cardiovascular Studies

  • AGTR1 polymorphisms (e.g., rs275652, rs275653) correlate with severe vascular pathologies . Recombinant receptors enable mechanistic studies of these variants.

  • In vitro assays: Measure Ca²⁺ flux or ERK phosphorylation to assess receptor activation .

B. Cancer Research

  • AGTR1 overexpression in breast cancer promotes metastasis via CXCR4/SDF-1α signaling . Recombinant proteins facilitate inhibitor screening (e.g., losartan analogs).

Challenges and Future Directions

  • Species-specific variations: Chimpanzee AGTR1 may exhibit subtle ligand-binding differences compared to human receptors.

  • Therapeutic targeting: Structural homology supports cross-species drug testing (e.g., ARBs like valsartan) .

  • Functional assays: Development of Pan troglodytes-specific cell lines or transgenic models is needed for validation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK IIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Uniprot No.

Target Background

Function
Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Pan troglodytes AGTR1?

The Pan troglodytes AGTR1 gene encodes the angiotensin II type 1 receptor, a G-protein coupled receptor featuring seven transmembrane domains. Similar to its human homolog, it likely contains a single promoter in the 5′ region with multiple regulatory sequences including TATA boxes, CAAT boxes, SP1 recognition sequences, and cyclic-AMP-induced responsive elements . The protein is expressed predominantly in vascular smooth muscle cells and organs including heart, adrenal gland, and kidney . Functionally, it mediates the major cardiovascular effects of angiotensin II, acting as a potent vasopressor hormone and regulator of aldosterone secretion . This receptor is crucial for blood pressure control and volume regulation in the cardiovascular system .

How does Pan troglodytes AGTR1 compare to human AGTR1?

Given the high genomic similarity between humans and chimpanzees (approximately 98-99% identity), AGTR1 is expected to share considerable sequence homology and functional properties across these species. The human AGTR1 gene is located on chromosome 3 and encodes a predominant short isoform composed of 359 amino acids with a molecular mass of 41.1 kDa . The human receptor is involved in blood pressure regulation, fluid and electrolyte balance, and cell growth and differentiation through activation of signal transduction pathways including PI3K/Akt and Ras/MAPK . Comparative analysis would be valuable to identify potential functional differences that might contribute to species-specific cardiovascular physiology.

What are the primary expression patterns of AGTR1 in chimpanzees?

While chimpanzee-specific expression data is limited in the search results, the expression pattern likely parallels that observed in humans. AGTR1 would be expected to be predominantly expressed in:

  • Vascular smooth muscle cells

  • Cardiac tissue

  • Adrenal glands, particularly in the cortex

  • Kidney structures, including glomeruli and tubules

  • Specific brain regions involved in cardiovascular regulation

These expression patterns would support the receptor's role in blood pressure regulation, fluid homeostasis, and response to physiological stress across tissues and organs.

What methodologies are optimal for producing functional recombinant Pan troglodytes AGTR1?

For optimal expression of recombinant Pan troglodytes AGTR1, researchers should consider:

Expression Systems:

  • Mammalian cell systems: HEK293 or CHO cells provide proper post-translational modifications and membrane integration essential for GPCR functionality

  • Insect cell systems: Sf9 cells with baculovirus vectors offer higher yields while maintaining most post-translational modifications

  • Yeast systems: P. pastoris can be suitable for large-scale production but may have different glycosylation patterns

Construct Design:

  • Include affinity tags (His, FLAG) for purification, preferably at the C-terminus

  • Consider codon optimization for the expression system

  • Include appropriate signal peptides for membrane targeting

When purifying the recombinant protein, researchers should use mild detergents (DDM, LMNG) for solubilization to preserve activity, followed by affinity chromatography and size exclusion chromatography steps . The CUSABIO validation data for human AGTR1 shows SDS-PAGE with 5% enrichment gel and 15% separation gel can effectively analyze the purified receptor, with the expected band size of approximately 42 kDa .

How can researchers verify the functional activity of recombinant Pan troglodytes AGTR1?

Functional verification should include multiple complementary approaches:

Binding Assays:

  • Radioligand binding using [125I]-labeled angiotensin II

  • Competition binding with known AGTR1 antagonists (e.g., losartan)

  • Determination of binding constants (Kd, Bmax)

Signaling Assays:

  • Calcium mobilization using fluorescent indicators

  • ERK1/2 phosphorylation via Western blot

  • Inositol phosphate accumulation measurements

Pharmacological Validation:

  • Dose-response relationships with agonists and antagonists

  • Comparison with human AGTR1 to identify species-specific differences

For Western blot validation, antibodies can be tested against whole cell lysates from appropriate cell lines (similar to the CUSABIO validation data showing detection in HeLa, Raji, and MCF-7 lysates for human AGTR1) .

What approaches are most effective for studying AGTR1-mediated signaling in Pan troglodytes?

AGTR1-mediated signaling in Pan troglodytes can be effectively studied through:

Cell Models:

  • Primary cells isolated from ethically sourced chimpanzee tissues

  • Immortalized chimpanzee cell lines expressing endogenous AGTR1

  • Human cell lines transfected with Pan troglodytes AGTR1

Signaling Analysis Techniques:

  • Phosphorylation assays for downstream effectors (ERK1/2, p38 MAPK, Akt)

  • Live-cell calcium imaging

  • Transcriptional profiling following receptor activation

  • Protein-protein interaction studies

Genetic Manipulation Approaches:

  • CRISPR-Cas9 gene editing to modify specific domains

  • RNA interference for selective knockdown

These approaches can be modeled after methodologies in search result , which describes genetic manipulation studies of AGTR1 in mice, adapted for chimpanzee systems.

How do genetic variations in AGTR1 compare between humans and chimpanzees?

Human AGTR1 polymorphisms have been extensively studied in relation to hypertension susceptibility and cardiovascular outcomes . Several polymorphisms in human AGTR1 have functional implications:

  • Promoter region variants (rs275651, rs275652, rs422858, rs275653) may affect transcription factor binding and alter promoter activity

  • Nonsynonymous mutations can affect binding affinities, cell surface expression, and response to angiotensin II

Comparative genomic analysis between human and chimpanzee AGTR1 could reveal:

  • Conserved regions likely critical for function

  • Species-specific variations that might confer differential cardiovascular physiology

  • Regulatory differences that could affect expression patterns

Research examining these differences would require extensive sequencing across chimpanzee populations and functional characterization of identified variants.

How should researchers approach AGTR1 genetic studies in chimpanzees?

Genetic studies of AGTR1 in chimpanzees should follow methodological approaches similar to those used in search result , which describes heritability analysis in chimpanzees:

Heritability Analysis:

  • Use quantitative genetics approaches applied to pedigree hierarchies

  • Software like Sequential Oligogenic Linkage Analysis Routines (SOLAR) can compute polygenic variance terms

  • Consider relevant covariates (age, sex, colony) in statistical models

Sample Collection and Processing:

  • Extract genomic DNA from blood samples or non-invasively collected materials

  • Develop PCR primers specific for Pan troglodytes AGTR1 sequences

  • Consider both coding regions and regulatory elements

Statistical Analysis:

  • Calculate additive genetic variance (h²) reflecting proportion of phenotypic variance attributable to genetic sources

  • Quantify effects of shared environments (c²) by incorporating maternal environment matrices

  • Assess genetic correlations (ρG) and environmental correlations (ρE) between phenotypes

These approaches would provide insight into the genetic architecture of AGTR1 variation in chimpanzees and its relationship to phenotypic differences in cardiovascular function.

What considerations are important when using antibodies for Pan troglodytes AGTR1 detection?

When selecting antibodies for Pan troglodytes AGTR1 research:

Antibody Selection:

  • Choose antibodies targeting epitopes with high sequence identity between human and chimpanzee AGTR1

  • Consider both polyclonal and monoclonal options, with polyclonals offering multiple epitope recognition

  • Validate human AGTR1 antibodies for cross-reactivity with chimpanzee protein

Validation Methods:

  • Western blot to verify single band of expected molecular weight (approximately 42 kDa)

  • Immunoprecipitation followed by mass spectrometry

  • Immunocytochemistry comparing staining patterns in cells with known expression profiles

  • Peptide competition assays to confirm specificity

Technical Considerations:

  • Optimize antibody concentration and incubation conditions

  • Use appropriate blocking reagents to minimize non-specific binding

  • Include positive controls (recombinant protein) and negative controls

Western blot protocols similar to those validated for human AGTR1 detection would be appropriate, with antibody concentrations around 1:2000 as used in the CUSABIO validation data .

What animal model alternatives exist for studying Pan troglodytes AGTR1 function?

Given ethical considerations in great ape research, several alternative approaches can be employed:

Cell-Based Systems:

  • Human cell lines transfected with Pan troglodytes AGTR1

  • Induced pluripotent stem cells (iPSCs) differentiated into relevant cell types

Chimeric Animal Models:

  • Mice with humanized or chimpanzee-ized AGTR1

  • Generation of knock-in models replacing mouse AGTR1 with chimpanzee sequence

Comparative Approaches:

  • Parallel studies across multiple non-human primate species

  • In silico modeling based on sequence differences

Bone Marrow Transplantation Models:
Similar to search result , bone marrow reconstitution experiments could be adapted to study specific aspects of AGTR1 function in immune cells, using appropriate species combinations .

How can researchers design functional experiments to compare human and chimpanzee AGTR1?

Comparative functional experiments should:

Expression Systems:

  • Express both receptors in the same cell background

  • Ensure equivalent expression levels through quantification

  • Use inducible systems for temporal control

Functional Comparisons:

  • Binding kinetics using identical ligands

  • Signal transduction activation (G-protein coupling, β-arrestin recruitment)

  • Desensitization and internalization dynamics

Pharmacological Profiling:

  • Response to common AGTR1 antagonists (losartan, candesartan)

  • Dose-response relationships for angiotensin II

  • Allosteric modulator effects

Chimeric Receptor Approach:

  • Generate domain-swapped receptors between human and chimpanzee

  • Map functional differences to specific receptor regions

These experiments would provide insight into evolutionary adaptations in AGTR1 function and potentially identify novel therapeutic targets.

How can Pan troglodytes AGTR1 research inform evolutionary medicine?

Comparative studies of AGTR1 across humans and chimpanzees can provide valuable insights:

Evolutionary Adaptations:

  • Identification of positively selected residues that might reflect adaptation to different physiological demands

  • Analysis of regulatory elements to understand species-specific expression patterns

  • Correlation of sequence differences with physiological parameters

Disease Susceptibility Differences:

  • Investigation of why certain cardiovascular pathologies show different prevalence between humans and chimpanzees

  • Examination of AGTR1 polymorphisms associated with hypertension in humans (e.g., essential hypertension, MIM:145500) and their presence/absence in chimpanzees

Therapeutic Implications:

  • Identification of conserved domains as potential robust drug targets

  • Discovery of species-specific responses that might predict drug efficacy or side effects

This research has potential implications for understanding human-specific susceptibilities to cardiovascular diseases and developing targeted therapies.

What insights can be gained from studying AGTR1 in mother-reared versus nursery-reared chimpanzees?

Search result provides valuable insights into how early rearing experiences affect gene expression and heritability in chimpanzees. Similar approaches could be applied to AGTR1 research:

Heritability Analysis by Rearing Condition:
In the study of psychopathy dimensions in chimpanzees, heritability estimates varied significantly by early rearing experience:

  • Mother-reared chimpanzees showed significant heritability for all three studied dimensions

  • Nursery-reared chimpanzees showed different patterns of heritability

Application to AGTR1 Research:

  • Investigation of whether AGTR1 expression and function is influenced by early rearing environment

  • Analysis of whether genetic contributions to AGTR1 variation differ between rearing groups

  • Examination of environmental correlations (ρE) between AGTR1 and other physiological parameters

This research could provide insight into how early life experience might program cardiovascular function through epigenetic or other mechanisms affecting AGTR1.

How does AGTR1 function in Pan troglodytes compare to other animal models?

Comparative analysis across species can provide important evolutionary context:

Cross-Species Comparison:

SpeciesAGTR1 Key FeaturesExperimental Applications
Pan troglodytesHigh homology to human (expected)Close evolutionary model for human disease
Homo sapiensLocated on chromosome 3; 359 amino acids; 41 kDa Clinical relevance and translational studies
Mus musculusFunctional in bone marrow-derived macrophages Genetic manipulation models
Other primatesVariable sequence homologyEvolutionary studies

The mouse model studies in search result demonstrate that AGTR1 functions in macrophages to preserve renal parenchymal architecture during urinary tract obstruction, with effects on phagocytosis . Similar comparative studies across species could reveal conserved and divergent functions of AGTR1.

What are the optimal purification strategies for recombinant Pan troglodytes AGTR1?

Purifying membrane proteins like AGTR1 presents unique challenges requiring specialized approaches:

Solubilization Methods:

  • Mild detergents: n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG)

  • Lipid nanodiscs for maintaining a native-like environment

  • Careful optimization of detergent:protein ratios

Chromatography Strategy:

  • Affinity chromatography using His-tag or FLAG-tag systems

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography as a polishing step

Quality Control:

  • SDS-PAGE with discontinuous gels (5% enrichment, 15% separation) as validated for human AGTR1

  • Western blot confirmation with specific antibodies

  • Ligand binding assays to verify functional activity

These approaches should be optimized for each specific expression system and downstream application.

How can researchers effectively design knockout or knockdown experiments for AGTR1 in chimpanzee cells?

Genetic manipulation of AGTR1 in chimpanzee cells requires:

CRISPR-Cas9 Approaches:

  • Design guide RNAs targeting early exons of Pan troglodytes AGTR1

  • Verify guide RNA specificity using chimpanzee genome databases

  • Include appropriate controls (non-targeting guides)

  • Validate knockout by sequencing and functional assays

RNA Interference:

  • Design siRNAs matching Pan troglodytes AGTR1 sequence

  • Use multiple siRNA sequences to ensure robust knockdown

  • Validate knockdown by qRT-PCR and Western blot

  • Confirm functional consequences through signaling assays

Validation Strategies:

  • Rescue experiments with wild-type AGTR1 to confirm specificity

  • Pharmacological validation using selective AGTR1 antagonists

  • Comparative analysis with human cells for translational relevance

These approaches draw on methodologies similar to those described for mouse AGTR1 studies , adapted for chimpanzee cell systems.

What considerations are important when designing binding assays for Pan troglodytes AGTR1?

Binding assay design for Pan troglodytes AGTR1 should address:

Radioligand Binding:

  • Use [125I]-labeled angiotensin II or synthetic angiotensin II analogs

  • Include appropriate controls for non-specific binding

  • Perform both saturation and competition experiments

Non-Radioactive Alternatives:

  • Fluorescence-based binding assays

  • Surface plasmon resonance for kinetic analysis

  • Time-resolved FRET approaches

Analysis Methods:

  • Use appropriate binding models (one-site, two-site)

  • Calculate key parameters (Kd, Bmax, EC50)

  • Compare with human AGTR1 binding properties under identical conditions

Specific Considerations for Chimpanzee Samples:

  • Source tissues ethically with appropriate permissions

  • Prepare membranes using conditions optimized for GPCR stability

  • Consider species-specific differences in optimal assay conditions

These approaches will provide valuable comparative data on ligand recognition and binding properties between human and chimpanzee AGTR1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.