Recombinant Pan troglodytes TYRO protein tyrosine kinase-binding protein (TYROBP)

What is TYROBP and what are its primary functions?

TYROBP (TYRO protein tyrosine kinase-binding protein), also known as DAP12 (DNAX-activation protein 12), is a transmembrane signaling polypeptide that contains an immunoreceptor phospho-tyrosine-based activation motif (ITAM) in its cytoplasmic domain. It functions as a transmembrane adaptor for multiple immune receptors, including TREM2 (triggering receptor expressed on myeloid cells 2) and CR3 (complement receptor 3), which are closely linked to Alzheimer's disease pathogenesis . TYROBP is expressed in microglia and plays a critical role in microglial environmental sensing function, having been identified as a network hub and driver in late-onset sporadic Alzheimer's disease (AD) .

What is the protein structure of Pan troglodytes TYROBP?

Pan troglodytes TYROBP is available as a full-length mature protein spanning amino acids 28-113. The amino acid sequence of the mature protein is QAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVHRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNMQRPYYK . This recombinant protein is typically fused to an N-terminal His tag when expressed in E. coli for research purposes .

How should recombinant TYROBP be stored and handled in laboratory settings?

Recombinant TYROBP should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For working aliquots, store at 4°C for up to one week . The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For reconstitution, briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage (the standard final concentration is 50%) .

What model systems are commonly used to study TYROBP function?

Based on the research data, several experimental models are used to study TYROBP function:

• Transgenic mouse models overexpressing TYROBP specifically in microglia (e.g., Iba1-Tyrobp mice)

• Mouse models of cerebral Aβ amyloidosis (APP/PSEN1 and 5xFAD mice)

• MAPT P301S transgenic mouse models of tauopathy

• Wild-type mice with cortical stab injury to study microglial recruitment

• Primary microglial cultures exposed to lipopolysaccharide (LPS) to induce activation

How does TYROBP expression change during microglial recruitment in neurodegeneration?

TYROBP transcription significantly increases in recruited microglia in various conditions. Using dual RNA in situ hybridization and immunohistochemistry for Tyrobp and IBA1 respectively, researchers have demonstrated that Tyrobp mRNA levels are extensively and selectively increased in microglia recruited in close proximity to amyloid plaques compared to microglia more distant from plaques in mouse models of cerebral amyloidosis (APP/PSEN1 and 5xFAD) . Similarly, increased Tyrobp mRNA has been detected in microglia in regions with elevated phosphorylated-TAU in MAPT P301S mice .

Interestingly, Tyrobp mRNA levels remain unchanged in primary microglia activated by LPS despite evidence of activation (increased Tnfα mRNA), suggesting that Tyrobp transcription increases specifically when microglia are both recruited and activated but not in activated resident microglia .

What experimental approaches can be used to investigate TYROBP-APOE signaling in microglia?

To investigate TYROBP-APOE signaling in microglia, researchers can employ several methodological approaches:

• Transgenic overexpression: Generate transgenic mice overexpressing TYROBP specifically in microglia (e.g., using the Iba1 promoter) and cross them with AD-related mouse models

• RNA in situ hybridization: Use dual RNA in situ hybridization and immunohistochemistry to simultaneously visualize Tyrobp mRNA and microglial markers around pathological features

• Genetic knockout models: Compare Tyrobp and Apoe expression in wild-type, Trem2-null, and Tyrobp-null backgrounds to dissect pathway dependencies

• Transcriptomic analysis: Perform bulk RNA sequencing on hippocampi to identify differential gene expression and upstream regulators

• Plaque-associated microglia analysis: Analyze gene expression specifically in microglia recruited around amyloid plaques using spatial transcriptomics or laser capture microdissection

How do TYROBP modifications affect amyloid and tau pathology in AD models?

TYROBP overexpression produces different effects in amyloid versus tau pathology models:

• In APP/PSEN1 mice (amyloid model): TYROBP overexpression results in a decrease of the amyloid burden

• In MAPT P301S mice (tau model): TYROBP overexpression leads to an increase in TAU phosphorylation

These divergent effects highlight the complex role of TYROBP in different aspects of AD pathology. Additionally, TYROBP overexpression alters the transcription of genes associated with APOE, including Axl, Ccl2, Tgfβ, and Il6, in both APP/PSEN1 and MAPT mouse models . Apolipoprotein E (Apoe) transcription was specifically upregulated in MAPT mice overexpressing TYROBP .

What methodological considerations are important when working with recombinant TYROBP in experimental studies?

When working with recombinant TYROBP protein:

• Purity assessment: Verify protein purity (>90%) using SDS-PAGE before experiments

• Reconstitution protocol: Follow precise reconstitution procedures to maintain protein stability and activity:

  • Centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

• Storage conditions: Store at -20°C/-80°C with proper aliquoting to avoid freeze-thaw cycles

• Application-specific validation: Test functionality in your specific application, as recombinant proteins may behave differently in various experimental contexts

• Avoid repeated freeze-thaw cycles which can lead to protein denaturation and loss of activity

How do researchers reconcile conflicting data regarding TYROBP's relationship with TREM2 in microglial activation?

The relationship between TYROBP and TREM2 in microglial activation presents some contradictions in research findings:

These findings provide compelling evidence that TYROBP-APOE signaling in the microglial sensome does not require TREM2. The hypothesis emerging from these studies is that activation of TREM2-independent TYROBP-APOE signaling could represent an early or even initiating step in the transformation of microglia from homeostatic phenotype to DAM .

To reconcile these contradictions, researchers should consider:

• Temporal aspects of microglial activation

• Differences in experimental models

• The possibility of parallel and/or redundant signaling pathways

What are the implications of TYROBP genetic variants in neurodegenerative diseases?

TYROBP genetic variants have significant implications in neurodegenerative conditions:

• Loss-of-function mutations in TYROBP can result in Nasu-Hakola disease, a rare polycystic leukoencephalopathy with bone cysts and presenile dementia

• TYROBP genetic variants have been identified in early-onset Alzheimer's disease

• Computational transcriptomics has identified TYROBP as a network hub and driver in late-onset sporadic Alzheimer's disease

• Loss vs. gain of function effects

• Cell type-specific consequences

• Interactions with other genetic risk factors

• Age-dependent effects

How should researchers interpret the differential effects of TYROBP in various AD pathology models?

The differential effects of TYROBP in various AD pathology models require careful interpretation:

TYROBP overexpression in APP/PSEN1 mice (amyloid model) decreases amyloid burden, while the same overexpression in MAPT P301S mice (tau model) increases TAU phosphorylation . These seemingly contradictory results suggest that TYROBP's role in neurodegeneration is complex and context-dependent.

When interpreting these differences, researchers should consider:

• The distinct pathological mechanisms of amyloid versus tau pathology

• The timing of TYROBP upregulation relative to disease progression

• The specific microglial phenotypes induced in different disease models

• The interaction between TYROBP and other molecules like APOE that may have different roles in amyloid versus tau pathology

• The possibility that TYROBP-mediated microglial responses may be protective against amyloid but detrimental for tau pathology

What experimental controls and validation methods are essential when studying TYROBP in neuroinflammation?

When studying TYROBP in neuroinflammation, several critical controls and validation methods should be implemented:

• Genetic controls:

  • Use of Tyrobp knockout mice to validate antibody specificity

  • Inclusion of Trem2 knockout controls to distinguish TREM2-dependent and independent pathways

  • Appropriate littermate controls for transgenic experiments

• Expression validation:

  • Dual RNA in situ hybridization and immunohistochemistry to confirm cell-specific expression patterns

  • Quantitative PCR to measure transcript levels

  • Western blot to confirm protein expression levels

• Functional assays:

  • Microglial recruitment assays (e.g., around plaques or injury sites)

  • Phagocytosis assays to measure functional consequences

  • Cytokine production measurement to assess inflammatory responses

• Pathology assessments:

  • Quantification of amyloid burden using multiple methods

  • Assessment of tau phosphorylation at different epitopes

  • Neurodegeneration markers and behavioral testing to correlate molecular findings with disease outcomes

What are the most effective methods for analyzing TYROBP-mediated signaling in microglia?

Effective methods for analyzing TYROBP-mediated signaling in microglia include:

• Phosphorylation analysis:

  • Western blotting with phospho-specific antibodies to detect ITAM phosphorylation

  • Phospho-proteomics to identify downstream signaling events

• Transcriptional profiling:

  • RNA sequencing of isolated microglia from different genetic backgrounds

  • Single-cell RNA sequencing to capture heterogeneity in microglial responses

  • Spatial transcriptomics to preserve information about microglial location relative to pathology

• Protein-protein interaction studies:

  • Co-immunoprecipitation to identify TYROBP binding partners

  • Proximity ligation assays to visualize protein interactions in situ

  • FRET-based approaches to study dynamic interactions

• Functional genomics:

  • CRISPR/Cas9-mediated gene editing in primary microglia

  • Inducible expression systems to study temporal effects of TYROBP signaling

• Imaging techniques:

  • Live imaging of calcium signaling or other second messengers

  • Super-resolution microscopy to visualize signaling complexes

  • Intravital imaging to study microglial dynamics in vivo

What considerations are important when designing experiments to study the TYROBP-APOE axis in neurodegeneration?

When designing experiments to study the TYROBP-APOE axis in neurodegeneration, researchers should consider:

• Temporal dynamics:

  • Include multiple time points to capture the progression of pathology

  • Consider early pre-symptomatic stages to identify initiating events

• Cell type specificity:

  • Use cell-type specific promoters for transgenic expression

  • Employ cell isolation techniques to analyze microglia separately from other cells

  • Consider single-cell approaches to account for microglial heterogeneity

• APOE isoform effects:

  • Include different APOE genotypes (ε2, ε3, ε4) to study isoform-specific effects

  • Consider humanized APOE mouse models

• Pathway dissection:

  • Generate compound mutants (e.g., Tyrobp overexpression with Trem2 knockout)

  • Use pharmacological inhibitors to target specific pathway components

  • Design rescue experiments to establish causality

• Translational relevance:

  • Include analyses of human samples when possible

  • Consider sex differences in experimental design

  • Correlate findings with clinical measures of disease progression

What are the exact specifications of recombinant Pan troglodytes TYROBP protein for research applications?

The recombinant Pan troglodytes TYROBP protein has the following specifications:

How can researchers optimize protein reconstitution protocols for TYROBP functional studies?

To optimize protein reconstitution protocols for TYROBP functional studies, researchers should follow these methodological steps:

• Initial preparation:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Work in a sterile environment to prevent contamination

• Reconstitution procedure:

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

  • Mix gently by inversion rather than vortexing to avoid protein denaturation

• Quality control:

  • Verify protein integrity via SDS-PAGE after reconstitution

  • Assess protein activity using functional assays specific to your experimental system

• Storage optimization:

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

• Application-specific considerations:

  • For cell-based assays, reconstitute in cell culture medium rather than water

  • For binding studies, consider adding stabilizing agents appropriate for the specific assay

  • For structural studies, optimize buffer conditions to maintain native conformation

What are the emerging areas of research regarding TYROBP in neurodegenerative diseases?

Emerging research areas for TYROBP in neurodegenerative diseases include:

• TREM2-independent TYROBP signaling:

  • Further characterization of the TYROBP-APOE axis that functions independently of TREM2

  • Investigation of this pathway as an early or initiating step in microglial transformation to the Disease-Associated Microglia (DAM) phenotype

• Therapeutic targeting:

  • Development of compounds that modulate TYROBP signaling

  • Investigation of timing-dependent interventions that may have different effects on amyloid versus tau pathology

• Biomarker development:

  • Exploration of TYROBP or related molecules as potential fluid biomarkers for neurodegeneration

  • Correlation of TYROBP genetic variants with disease progression

• Systems biology approaches:

  • Further computational network analyses to identify additional TYROBP-interacting pathways

  • Multi-omics integration to understand TYROBP's role in different cell types and disease stages

• Expanded disease relevance:

  • Investigation of TYROBP's role in other neurodegenerative conditions beyond Alzheimer's disease

  • Exploration of TYROBP function in systemic inflammation and its impact on neurodegeneration

How might technological advances in protein engineering impact future TYROBP research?

Technological advances in protein engineering could significantly impact future TYROBP research in several ways:

• Structure-function studies:

  • Development of TYROBP variants with modified binding domains to dissect interaction specificity

  • Creation of biosensors based on TYROBP to monitor signaling dynamics in real-time

• Improved recombinant proteins:

  • Engineering more stable versions of TYROBP with extended shelf-life

  • Development of tagged variants for specific experimental applications without compromising function

• Cell-specific delivery systems:

  • Design of microglial-targeted TYROBP modulators for therapeutic applications

  • Development of conditional expression systems for temporal control of TYROBP function

• High-throughput screening platforms:

  • Creation of TYROBP-based screening assays to identify novel binding partners or modulators

  • Development of reporter systems to monitor TYROBP-dependent signaling

• In vivo imaging tools:

  • Engineering of TYROBP fusion proteins compatible with in vivo imaging

  • Development of PET ligands or other imaging modalities to monitor TYROBP expression or activity in living subjects