Recombinant Pan troglodytes Vomeronasal type-1 receptor 3 (VN1R3)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant VN1R3 is a full-length, His-tagged version of the chimpanzee vomeronasal type-1 receptor 3 expressed in E. coli . As a member of the V1R family, it is hypothesized to function in pheromone detection through G protein-coupled receptor (GPCR) signaling pathways . Unlike humans, where most V1R genes are pseudogenized, chimpanzees retain functional V1Rs, making this recombinant protein critical for comparative evolutionary studies .

Key Features:

PropertyDetail
UniProt IDQ7YRP3
Amino Acid Sequence310 residues, starting with MASKDFAIGMILSQIMVGFLGN...
DomainsPredicted seven-transmembrane GPCR structure, characteristic of V1Rs
Post-Translational ModificationsNone reported; recombinant expression in E. coli avoids eukaryotic modifications .

The protein includes conserved motifs for ligand binding and Gαi2 coupling, as observed in apical vomeronasal sensory neurons (VSNs) of rodents . Its sequence divergence from mouse V1Rs suggests species-specific ligand preferences .

Genomic and Phylogenetic Context

  • Gene Cluster: VN1R3 belongs to the V1R multigene family, which in mice is organized into large chromosomal clusters (e.g., 21–48 genes per cluster) . While chimpanzee V1R clusters remain uncharacterized, their retention of functional genes contrasts with humans, where pseudogenization is prevalent .

  • Evolutionary Significance: V1Rs in non-primate mammals drive innate behaviors via pheromone signaling . The functional preservation of VN1R3 in chimpanzees implies ongoing selective pressure, potentially linked to social or reproductive communication .

Research Applications

  • Ligand Identification: Used in binding assays to identify pheromones or kairomones, though no ligands are currently confirmed for VN1R3 .

  • Comparative Studies: Contrasted with human V1R pseudogenes (e.g., UniProt entries like Q7YRP3 vs. non-functional human homologs) to explore evolutionary divergence .

  • Neuronal Signaling Pathways: Investigates coupling to Gαi2 proteins, which mediate inositol trisphosphate signaling in apical VSNs .

Challenges and Future Directions

  • Functional Data Gap: No direct evidence links VN1R3 to specific behaviors or ligands, reflecting broader limitations in V1R research .

  • Structural Biology: Solving its 3D structure could clarify ligand-binding mechanisms and evolutionary adaptations .

  • In Vivo Models: Transgenic expression in mice (e.g., using BAC transgenes as in ) may reveal its role in chemosensory behaviors.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
VN1R3; V1RL3; Vomeronasal type-1 receptor 3; V1r-like receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
VN1R3
Target Protein Sequence
MASKDFAIGMILSQIMVGFLGNFFLLYHYSFLHFTRGMLQSTDLTLKHLTIANSLVILSK GIPQTMAAFGLKDSLSDIGCKFVFYVHRVGRAVCTGNACLLSVFQVITISSSEFRWAELK LHAHKYIRSFILVLCWILNTLVNITVPLHVTGKWNSINSTKTNDYGYCSGGSRSRIPHSL HIVLLSSLDVLCLGLMTLASGSMVFILHRLKQQVQHIHGTNLSPRSSPESRVTQSILVLV STLCYFTRSPPSLHMSLFPNPSWWPLNASALITACFPTVSPFVLMSRHPRIPRLGSACCG RNPQFPKLVR
Uniprot No.

Target Background

Function
Putative pheromone receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What evidence supports the evolutionary deterioration of the vomeronasal system in Pan troglodytes?

Multiple lines of evidence support the evolutionary deterioration of the vomeronasal system in Pan troglodytes and other catarrhine primates:

  • Genetic Evidence: Analysis of TRP2 ion channel and V1R pheromone receptor genes (including VN1R3) shows they have been impaired and removed from functional constraints since approximately 23 million years ago .

  • Molecular Clock Analysis: Examination of substitution rates and dN/dS ratios indicates relaxed selection on these genes in hominoids and Old World monkeys compared to species with functional vomeronasal systems .

  • Anatomical Evidence: Chimpanzees, like humans, possess only vestigial vomeronasal organs, consistent with reduced functional significance .

  • Correlated Trait Evolution: The phylogenetic distribution of vomeronasal pheromone insensitivity aligns with the development of alternative communication systems, such as conspicuous female sexual swelling and male trichromatic color vision, suggesting functional replacement .

To properly study this evolutionary deterioration, researchers should employ a comprehensive approach incorporating molecular phylogenetics, comparative genomics, and when possible, functional assays to determine residual activity of these receptors.

How does the evolutionary history of VN1R3 in Pan troglodytes inform our understanding of sensory system adaptation?

The evolutionary history of VN1R3 in Pan troglodytes provides a valuable case study in sensory system adaptation and replacement. Research indicates that the vomeronasal pheromone transduction pathway's deterioration coincided with the enhancement of vision-based signaling systems in catarrhines . This pattern suggests that:

  • Sensory systems can undergo replacement when environmental or social conditions favor alternative modalities of communication.

  • The shift from chemical to visual signaling in catarrhine primates may have been driven by ecological factors (such as the transition from nocturnal to diurnal lifestyles) or social factors (such as changes in mating systems).

  • Gene pseudogenization follows a predictable pattern when functional constraints are relaxed.

For researchers, this underscores the importance of studying sensory receptors within their broader evolutionary and ecological context. Methodologically, this requires an interdisciplinary approach incorporating molecular genetics, behavioral ecology, and comparative physiology to fully understand the adaptive significance of sensory system evolution.

What are the best methods for expressing and purifying recombinant Pan troglodytes VN1R3 for functional studies?

For successful expression and purification of recombinant Pan troglodytes VN1R3, researchers should consider the following methodological approach:

  • Expression System Selection: While E. coli expression systems are commonly used (as indicated in the product information), membrane proteins like VN1R3 may benefit from eukaryotic expression systems such as yeast, insect cells, or mammalian cells that provide appropriate post-translational modifications and membrane environments .

  • Construct Design: Include a His-tag or other affinity tag to facilitate purification. Consider codon optimization for the expression system chosen .

  • Protein Extraction and Purification:

    • For membrane proteins, proper detergent solubilization is crucial

    • Utilize affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

    • Consider size exclusion chromatography for further purification

  • Storage Conditions: Store in appropriate buffer conditions with stabilizing agents such as glycerol (30-50%) at -20°C or -80°C to maintain protein integrity .

  • Quality Control: Verify protein identity and purity using SDS-PAGE, Western blotting, and mass spectrometry.

How can researchers design controlled experiments to assess potential residual function of Pan troglodytes VN1R3?

Designing controlled experiments to assess potential residual function of Pan troglodytes VN1R3 requires careful consideration of experimental design principles:

  • Receptor Expression Systems:

    • Heterologous expression in cell lines (HEK293, CHO)

    • Inclusion of positive controls (functionally characterized vomeronasal receptors from species with intact systems)

    • Negative controls (mock-transfected cells)

  • Functional Assays:

    • Calcium imaging to detect ligand-induced signaling

    • BRET/FRET assays to measure receptor conformational changes

    • Electrophysiological recordings to detect channel activity

  • Ligand Panel Selection:

    • Include diverse potential pheromones and related chemicals

    • Test concentration gradients to determine dose-response relationships

    • Include known ligands for related receptors as positive controls

  • Variables Control:

    • Independent variables: ligand type, ligand concentration, receptor variant

    • Dependent variables: receptor activation metrics (calcium flux, current, etc.)

    • Control for extraneous variables such as cell passage number, transfection efficiency, and assay conditions

  • Statistical Analysis:

    • Appropriate statistical tests (ANOVA, t-tests)

    • Multiple testing correction

    • Effect size calculation

This experimental design follows true experimental research design principles, with proper variable manipulation and control groups to establish causality in receptor function .

How should researchers address potential contradictions in VN1R3 functional data across different experimental platforms?

When confronted with contradictory data regarding VN1R3 function across different experimental platforms, researchers should implement a systematic approach to data quality assessment and reconciliation:

  • Identify Interdependent Variables: Determine which experimental parameters (α) might influence each other across platforms. For VN1R3 research, these could include expression system, membrane composition, assay temperature, and ligand preparation method .

  • Document Contradictory Dependencies (β): Clearly document all contradictory results with their associated experimental conditions. For example, if VN1R3 shows activity in one assay system but not another, detail all differences between systems .

  • Establish Minimal Boolean Rules (θ): Develop the minimal set of Boolean conditions that can explain the contradictions. This approach reduces complex interdependencies to their essential logical components .

  • Implement Cross-Validation: Design experiments specifically to test hypotheses about why contradictions occur, using:

    • Within-platform replication

    • Cross-platform validation

    • Intermediate condition testing to establish boundary conditions

  • Structured Reporting: Document all contradictions using the (α,β,θ) notation to ensure clear communication of data quality issues .

This methodological approach acknowledges that contradictions in complex biological data are informative rather than merely problematic, potentially revealing important context-dependent aspects of receptor function.

What quality control measures are essential when working with recombinant VN1R3 protein?

Essential quality control measures for recombinant VN1R3 protein research include:

  • Protein Purity Assessment:

    • SDS-PAGE analysis with minimum 90% purity standard

    • Mass spectrometry verification of protein identity

    • Western blot confirmation using anti-VN1R3 or anti-tag antibodies

  • Functional Integrity Verification:

    • Secondary structure analysis (circular dichroism)

    • Thermal stability assessment

    • Ligand binding capacity (if known ligands exist)

  • Storage Stability Monitoring:

    • Avoid repeated freeze-thaw cycles

    • Aliquot preparations appropriately

    • Include cryoprotectants such as 5-50% glycerol

    • Perform periodic quality checks on stored samples

  • Batch Consistency:

    • Maintain detailed records of preparation conditions

    • Establish internal standards for batch-to-batch comparison

    • Document any deviations in protein characteristics

  • Environmental Condition Control:

    • Monitor pH stability (recommended in Tris/PBS-based buffer, pH 8.0)

    • Control temperature during experiments

    • Protect from oxidation if applicable

How might researchers investigate the potential non-VNO-mediated functions of VN1R3 in catarrhine primates?

Despite the deterioration of the traditional vomeronasal organ pathway in catarrhines, VN1R3 and related receptors may have evolved alternative functions. To investigate these potential non-VNO-mediated functions, researchers could employ the following methodological approaches:

This investigation acknowledges that while VNO-mediated pheromone sensitivity was reduced in catarrhines, certain non-VNO-mediated responses to putative pheromones have been documented in other mammals, suggesting potential alternative functions .

What computational approaches can predict potential ligands for Pan troglodytes VN1R3 despite its evolutionary constraints?

Despite evolutionary constraints on VN1R3 function in Pan troglodytes, computational approaches can still provide valuable insights into potential ligands. Researchers should consider these methodological strategies:

These computational predictions should then inform experimental validation studies, creating an iterative process of refinement and discovery that may reveal unexpected functions or interactions of VN1R3 despite its evolutionary trajectory in catarrhines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.