Recombinant Pan troglodytes XK-related protein 7 (XKR7)

Shipped with Ice Packs
In Stock

Description

Functional Role in Apoptosis and Cell Signaling

XKR7 is implicated in apoptotic processes, though its mechanistic role differs from other XKR family members:

  • Phosphatidylserine (PtdSer) exposure: While XKR4, XKR8, and XKR9 directly mediate PtdSer scrambling during apoptosis, XKR7 lacks this activity despite sharing structural motifs .

  • Engulfment signaling: Predicted to facilitate apoptotic cell clearance by macrophages, though experimental validation in chimpanzee models is pending .

  • Caspase interaction: Contains a conserved caspase recognition site (AERDG), but mutagenesis studies show no activation of phospholipid scrambling, unlike XKR8 .

Table 2: Functional Differences Among XKR Family Members

ProteinCaspase Cleavage SitePtdSer ScramblingTissue Expression
XKR4AERDG (C-terminal)YesBrain-specific
XKR8DQVDG (C-terminal)YesUbiquitous
XKR9DETDG (C-terminal)YesIntestine-specific
XKR7AERDG (C-terminal)NoUndetermined (in vitro)

Future Research Directions

Key unresolved questions include:

  • Mechanistic role: Whether XKR7 functions as an ion channel or interacts with species-specific cofactors .

  • Tissue-specific expression: Mapping its distribution in chimpanzee organs to clarify physiological relevance .

  • Disease associations: Potential links to neurodegenerative or autoimmune disorders via aberrant apoptosis pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
XKR7; XRG7; XK-related protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
XKR7
Target Protein Sequence
MAAKSDGAAASAGPDPEGAAGGARGSAGGRGEAAAAAGPPGVVGAGGPGPRYELRDCCWV LCALLVFFSDGATDLWLAASYYLQNQHTYFSLTLLFVLLPSLVVQLLSFRWFVYDYSEPA GSPGPAVSTKDSVAGGAAISTKDSAGAFRTKEGSPEPGPQPAPSSASAYRRRCCRLCIWL LQTLVHLLQLGQVWRYLRALYLGLQSRWRGERLRRHFYWQMLFESADVSMLRLLETFLRS APQLVLQLSLLVHRGGAPDLLPALSTSASLVSLAWTLASYQKVLRDSRDDKRPLSYKGAV AQVLWHLFSIAARGLAFALFASVYKLYFGICIVGHWSVMTFWVIQGETDFCMSKGEEIIY NMVVGIIYIFCWFNVKEGRSRRRMTLYHCIVLLENAALTGFWYSSRNFSTDFYSLIMVCV VASSFALGIFFMCVYYCLLHPNGPMLGPQAPGCIFRKASEPCGPPADAITSPPRSLPRTT GAERDGASAGERAGTPTPPVFQVRPGLPPTPVARTLRTEGPVIRIDLPRKKYPAWDAHFI DRRLRKTILALEYSSPATPRLQYRSVGTSQELLEYETTV
Uniprot No.

Target Background

Database Links

KEGG: ptr:458161

UniGene: Ptr.6360

Protein Families
XK family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pan troglodytes XK-related protein 7 (XKR7) and how does it compare to the human ortholog?

Recombinant Pan troglodytes XK-related protein 7 (XKR7) is a member of the XK-related protein family derived from chimpanzees (Pan troglodytes). This protein belongs to a family that includes multiple XK-related proteins numbered XKR1 through XKR9 . The Pan troglodytes XKR7 shares significant sequence homology with human XKR7 (also known as C20orf159, dJ310O13.4), though there are species-specific variations in certain domains that may affect functional characteristics . The human ortholog is encoded on chromosome 20 as indicated by one of its alternative names (C20orf159) . Both proteins are typically expressed as membrane transport proteins, suggesting roles in cellular trafficking or transport mechanisms.

When comparing experimental applications, researchers should note that while the core functional domains remain conserved between species, the subtle structural differences may influence protein-protein interactions, post-translational modifications, and ultimately experimental outcomes when used in heterologous systems.

What expression systems are most effective for producing Recombinant Pan troglodytes XKR7?

Multiple expression systems have been validated for the production of Recombinant Pan troglodytes XKR7, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsTypical YieldRecommended Applications
E. coliCost-effective, rapid production, scalableLimited post-translational modifications, potential inclusion body formation2-5 mg/LStructural studies, antibody production
YeastProper protein folding, some post-translational modificationsModerate cost, hyperglycosylation issues5-20 mg/LFunctional assays requiring basic modifications
BaculovirusSuperior folding, extensive post-translational modificationsHigher cost, longer production time10-50 mg/LComplex functional studies, interaction analyses
Mammalian CellNative-like modifications, proper membrane insertionHighest cost, complex protocols, longer timeframes1-10 mg/LStudies requiring physiological relevance, trafficking studies
Cell-Free ExpressionRapid production, avoids cellular toxicity issuesLimited post-translational modificationsVariablePreliminary studies, high-throughput screening

As evidenced in the literature, Cell-Free Expression systems have been successfully employed for producing Recombinant Pan troglodytes XKR7 with appropriate purity levels (≥85% as determined by SDS-PAGE) . For partial protein expression, E. coli, yeast, baculovirus, and mammalian cell systems have all been documented as viable production platforms .

What purification methods yield the highest purity for Recombinant Pan troglodytes XKR7?

Achieving high purity Recombinant Pan troglodytes XKR7 requires a strategic multi-step purification protocol. Standard methods consistently yield preparations with ≥85% purity as determined by SDS-PAGE analysis . The recommended purification workflow includes:

  • Initial Extraction: For membrane-associated XKR7, detergent-based extraction (typically using mild non-ionic detergents like DDM or CHAPS) preserves structural integrity.

  • Affinity Chromatography: Utilizing either epitope tags (His, FLAG, GST) engineered into the recombinant construct or natural binding partners as ligands.

  • Size Exclusion Chromatography (SEC): Critical for removing aggregates and separating monomeric XKR7 from oligomeric forms.

  • Ion Exchange Chromatography: Particularly useful as a polishing step to remove closely related contaminants based on charge differences.

For applications requiring exceptionally high purity (>95%), coupling the above methods with additional techniques such as hydroxyapatite chromatography or hydrophobic interaction chromatography may be necessary. The final purified product should be validated using multiple analytical methods including SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity.

How should Recombinant Pan troglodytes XKR7 be stored to maintain activity?

Optimal storage conditions for Recombinant Pan troglodytes XKR7 vary depending on timeframe and intended application:

Storage DurationRecommended ConditionsBuffer CompositionAdditivesActivity Retention
Short-term (1-7 days)4°C20 mM Tris-HCl pH 7.5, 150 mM NaCl0.02% detergent for membrane forms>95%
Medium-term (1-4 weeks)-20°C20 mM Tris-HCl pH 7.5, 150 mM NaCl10% glycerol, protease inhibitors80-90%
Long-term (months to years)-80°C20 mM Tris-HCl pH 7.5, 150 mM NaCl20% glycerol, protease inhibitors70-85%
LyophilizedRoom temperature (desiccated)Lyophilization buffer with cryoprotectantsTrehalose or sucrose>90% after reconstitution

For membrane-associated forms of XKR7, inclusion of appropriate detergents at concentrations above their critical micelle concentration (CMC) is essential to prevent aggregation and maintain native conformation. Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity. Aliquoting the purified protein before freezing is strongly recommended.

What experimental designs are most appropriate for studying XKR7 function in cellular models?

Investigating XKR7 function demands robust experimental designs that account for both the membrane-associated nature of the protein and potential species-specific interactions. Implementation science approaches suggest several viable experimental frameworks:

Randomized Controlled Trials (RCTs) for XKR7 Research:
Implementing a cell-based RCT design allows for rigorous assessment of XKR7 function while controlling for confounding variables . This approach typically involves:

  • Random assignment of cultured cells to experimental groups (XKR7-expressing vs. control)

  • Standardized intervention protocols for introducing recombinant XKR7

  • Blinded assessment of cellular outcomes

  • Statistical power analysis to determine appropriate sample sizes

Sequential Multiple Assignment Randomized Trials (SMART):
For studying dynamic processes involving XKR7, such as membrane trafficking or signaling cascades, SMART designs offer advantages by allowing adaptive intervention strategies based on cellular responses over time .

Quasi-Experimental Approaches:
When complete randomization is impractical, interrupted time series (ITS) designs can effectively track XKR7-dependent cellular changes before and after intervention . This is particularly valuable for studying temporal aspects of XKR7 function in stable cell lines.

The experimental design should incorporate appropriate controls including:

  • Empty vector controls

  • Inactive mutant XKR7 controls

  • Human XKR7 comparative groups to assess species-specific functions

Implementing these designs requires careful consideration of cell type selection, expression levels, and measurement timing to capture the full spectrum of XKR7-mediated effects.

How can researchers effectively compare functional differences between Pan troglodytes XKR7 and other XK-related proteins?

Comparative analysis of Pan troglodytes XKR7 against other XK-related proteins requires a multifaceted approach spanning computational, biochemical, and cellular methodologies:

Computational Comparative Analysis:

  • Sequence alignment using MUSCLE or CLUSTAL algorithms to identify conserved domains across XKR family members (XKR1-XKR9)

  • Phylogenetic analysis to establish evolutionary relationships

  • Structural modeling to predict functional motifs unique to XKR7

Biochemical Characterization:
Systematic comparison should include:

PropertyRecommended AssayExpected DifferencesControl Proteins
Membrane TopologyProtease protection assaysNumber and orientation of transmembrane domainsXKR4, XKR8
Protein-Protein InteractionsCo-immunoprecipitation or proximity labelingInteracting partners specific to XKR7Other XKR family members
Post-translational ModificationsMass spectrometryUnique modification patternsHuman XKR7
Lipid InteractionsLiposome binding assaysPreferential binding to specific phospholipidsXKR8, XKR9

Functional Comparison in Cellular Systems:
Comprehensive analysis should include expressing multiple XKR family members in parallel experimental systems, followed by functional readouts such as:

  • Membrane permeability changes

  • Phosphatidylserine exposure (particularly relevant for XKR8 comparison)

  • Cell death sensitivity

  • Trafficking dynamics using fluorescently tagged constructs

This methodical comparison will illuminate both the conserved functions of the XKR family and the unique properties of Pan troglodytes XKR7.

What are the key considerations for designing antibodies against Pan troglodytes XKR7 for research applications?

Developing effective antibodies against Pan troglodytes XKR7 presents several technical challenges that require strategic planning:

Epitope Selection Considerations:

Epitope RegionAdvantagesLimitationsCross-Reactivity Risk
N-terminal domainGenerally accessibleMay be processed in vivoModerate with other XKR proteins
C-terminal domainOften cytoplasmic and accessiblePotential PDZ-binding motifs may be maskedLow-moderate
Extracellular loopsNative conformation epitopesChallenging for antibody accessLow
Unique sequence regionsHigh specificityMay lack immunogenicityMinimal

Production Methodology:
For optimal results, researchers should consider:

  • Antigen Format: Using both synthetic peptides and recombinant protein fragments to maximize epitope diversity

  • Host Selection: Rabbit systems have shown successful generation of XK-related protein antibodies

  • Validation Requirements: Confirming specificity against both recombinant protein and native expression in chimpanzee tissues

  • Purification Approach: Affinity purification against the immunizing antigen is essential to reduce non-specific binding

Application-Specific Considerations:
When developing antibodies, researchers should validate performance in specific applications:

  • Western blotting may require denaturing-resistant epitopes

  • Immunoprecipitation necessitates native conformation recognition

  • Immunohistochemistry may require different fixation-resistant epitopes

Cross-validation using multiple antibodies targeting different regions of XKR7 is strongly recommended to confirm experimental observations and minimize epitope-specific artifacts.

What structural and functional domains characterize Pan troglodytes XKR7, and how do they influence experimental approaches?

Pan troglodytes XKR7 exhibits a complex domain architecture that dictates both its biological function and experimental handling requirements:

Core Structural Elements:

DomainAmino Acid PositionPredicted FunctionExperimental Implications
Transmembrane domains (predicted 9)VariousMembrane integrationRequires detergent for solubilization
N-terminal cytoplasmic domain1-45 (approx.)Regulatory interactionsAccessible for tagging strategies
C-terminal cytoplasmic domain420-476 (approx.)Signaling, protein-protein interactionsPotential regulatory site
Extracellular loopsVariousLigand binding, structural stabilityPotential antibody targets
Conserved XK domain150-300 (approx.)Core XK family functionCritical for comparative studies

Functional Regions:
The protein contains several predicted functional motifs including potential phosphorylation sites, glycosylation sites, and membrane insertion signals. These features necessitate expression in systems capable of appropriate post-translational modifications for functional studies.

Experimental Strategy Implications:

  • Truncation Studies: Domain-specific constructs should carefully consider transmembrane boundaries to avoid misfolding

  • Tagging Approaches: N-terminal tags generally preserve function better than C-terminal modifications

  • Mutagenesis Targets: Conserved residues among XKR family members represent priority targets for structure-function analysis

  • Solubilization Protocols: Different detergents may preferentially extract and maintain the integrity of specific domains

Understanding these structural elements informs experimental design decisions from construct generation through functional testing, particularly when comparing with human XKR7 or other family members .

How can researchers effectively design expression vectors for studying Pan troglodytes XKR7 in different cellular contexts?

Designing optimal expression vectors for Pan troglodytes XKR7 requires thoughtful consideration of multiple parameters to ensure proper expression, localization, and function:

Vector Design Elements:

ElementRecommendationRationaleConsiderations
PromoterCMV for high expression; Tet-inducible for controlled studiesExpression level controlCell type-specific activity varies
Tag LocationN-terminal for minimal functional impactC-terminus may interfere with trafficking signalsConsider TEV cleavage sites for tag removal
Selection MarkerPuromycin for mammalian cells; Hygromycin for stable linesEfficient selectionConcentration optimization required for each cell line
Kozak SequenceStrong consensus (GCCACCATGG)Ensures efficient translation initiationMay need optimization for specific expression systems
Codon OptimizationRecommended for non-primate expression systemsImproves expression yieldDifferent algorithms available for system-specific optimization

Expression System Compatibility:
Recombinant Pan troglodytes XKR7 has been successfully expressed in various systems including E. coli, yeast, baculovirus, mammalian cells, and cell-free expression systems . Each requires specific vector elements:

  • E. coli expression: pET or pGEX vectors with T7 promoter

  • Mammalian expression: pcDNA3.1 or pCMV vectors with CMV promoter

  • Baculovirus expression: pFastBac vectors with polyhedrin promoter

  • Yeast expression: pPICZ vectors with AOX1 promoter

Specialized Modifications:
For advanced applications, consider:

  • Bicistronic design with fluorescent reporters to track expression

  • Lentiviral backbone for difficult-to-transfect cell types

  • Tissue-specific promoters for in vivo studies

  • Signal sequence modifications to enhance membrane targeting

Careful validation of protein expression, localization, and function should follow vector construction to ensure the recombinant XKR7 behaves physiologically.

What analytical methods best characterize the interaction of Pan troglodytes XKR7 with other cellular components?

Elucidating the interactions between Pan troglodytes XKR7 and other cellular components requires a multi-methodological approach spanning from in vitro biochemical assays to advanced cellular imaging:

Protein-Protein Interaction Methods:

MethodApplicationAdvantagesLimitationsKey Controls
Co-immunoprecipitationEndogenous interactionsPhysiologically relevantMay miss weak/transient interactionsIgG control, reverse IP
Proximity Labeling (BioID/APEX)Spatial interactome mappingCaptures transient interactionsPotential false positivesBirA* only control
FRET/BRETReal-time interaction dynamicsLive cell measurementsRequires fluorescent tagsAcceptor/donor only controls
Yeast Two-HybridSystematic screeningHigh-throughput capabilityHigh false positive rateAutoactivation controls

Membrane Interaction Analysis:
For characterizing XKR7's interaction with membrane components:

  • Lipidomics analysis of co-purifying lipids

  • Fluorescence recovery after photobleaching (FRAP) for membrane mobility

  • Detergent resistance assays for lipid raft association

  • Density gradient fractionation for membrane microdomain localization

Functional Interaction Mapping:
Understanding functional relationships requires:

  • CRISPR screening for genetic interactions

  • Pharmacological perturbation combined with XKR7 expression

  • Quantitative proteomics before and after XKR7 induction

  • Single-cell analysis of co-expression patterns

Data Integration Approach:
The most robust characterization comes from integrating multiple methodologies and confirming key interactions through orthogonal techniques. Computational network analysis should be applied to identify high-confidence interactions and place XKR7 within relevant cellular pathways.

What are the most effective experimental designs for studying XKR7 function in comparative biochemistry?

When investigating XKR7 function across species or comparing it with other XK-related proteins, researchers should implement rigorous experimental designs that maximize internal validity while addressing the unique challenges of membrane protein biology:

Randomized Block Design:
This approach is particularly valuable when comparing Pan troglodytes XKR7 with human XKR7 or other homologs. By blocking experimental units based on factors like expression level or cell passage number, researchers can reduce noise and increase statistical power .

Sequential Multiple Assignment Randomized Trial (SMART) Design:
For studying dynamic processes involving XKR7, SMART designs allow adaptive protocols that respond to intermediate outcomes . This is especially valuable when investigating signaling cascades or trafficking dynamics where sequential interventions may be necessary.

Implementation Considerations:
When designing comparative experiments:

  • Expression Normalization: Use quantitative western blotting or fluorescence calibration to ensure comparable expression levels across protein variants

  • Temporal Synchronization: Implement inducible expression systems for precisely timed experiments

  • Environmental Standardization: Control temperature, pH, and ionic conditions precisely across experimental groups

  • Randomization: Assign experimental units to conditions using true randomization methods

  • Blinded Analysis: Implement blinded scoring for subjective measurements

Statistical Approach:
Power analysis should guide sample size determination, with consideration for the typically high variability in membrane protein experiments. Mixed-effects models are often appropriate for analyzing nested experimental designs in this context .

How should researchers approach the validation of antibodies targeting Pan troglodytes XKR7?

Antibody validation is critical for ensuring reliable results in XKR7 research. A comprehensive validation protocol includes:

Multi-tiered Validation Strategy:

Validation LevelMethodsSuccess CriteriaCommon Pitfalls
Primary ValidationWestern blot against recombinant proteinSingle band of expected MWCross-reactivity with other XKR family members
Secondary ValidationImmunoprecipitation followed by mass spectrometryXKR7 peptides identifiedNon-specific binding to hydrophobic proteins
Functional ValidationImmunofluorescence or flow cytometryExpected subcellular localizationFixation-dependent epitope masking
Specificity TestingTesting in XKR7 knockout/knockdown modelsSignal reduction/eliminationIncomplete knockdown leading to residual signal

Cross-Species Reactivity Assessment:
When validating antibodies raised against Pan troglodytes XKR7 :

  • Test against human XKR7 to determine cross-reactivity

  • Evaluate against other primate samples if available

  • Assess potential cross-reactivity with mouse/rat XKR7 for in vivo studies

Application-Specific Validation:
Different applications require specific validation parameters:

  • For Western blotting: Validate under both reducing and non-reducing conditions

  • For immunohistochemistry: Test multiple fixation protocols

  • For flow cytometry: Validate with both fixed and live cells

  • For ChIP applications: Confirm DNA binding specificity

Documentation Requirements:
Maintain comprehensive records including:

  • Antibody source, catalog number, and lot

  • Validation experimental details and raw data

  • Positive and negative control results

  • Application-specific optimization parameters

What are the critical quality control parameters for assessing recombinant Pan troglodytes XKR7 preparations?

Ensuring consistent, high-quality recombinant Pan troglodytes XKR7 preparations requires rigorous quality control procedures across multiple parameters:

Essential Quality Control Metrics:

ParameterAnalytical MethodAcceptance CriteriaTroubleshooting Approach
PuritySDS-PAGE with densitometry≥85% purity Additional purification steps
IdentityMass spectrometryMatches theoretical massCheck for truncations/modifications
HomogeneitySize exclusion chromatographySingle predominant peakOptimize buffer conditions
Structural IntegrityCircular dichroismConsistent secondary structure profileVary buffer components
FunctionalityApplication-specific assaysActivity within 20% of reference standardAssess storage conditions

Critical Process Parameters:
Monitoring these factors during production ensures consistent quality:

  • Expression level: Yield quantification at each production stage

  • Solubilization efficiency: Percentage of target protein extracted

  • Purification recovery: Yield after each purification step

  • Endotoxin levels: LAL assay for preparations from bacterial systems

  • Host cell protein contamination: ELISA-based detection

Stability Testing Protocol:
For each production batch, stability should be assessed by:

  • Accelerated stability testing at elevated temperatures

  • Real-time stability monitoring under standard storage conditions

  • Freeze-thaw stability through multiple cycles

  • Functional activity retention over time

How can contradictory data regarding XKR7 function be resolved through improved experimental design?

When faced with contradictory findings regarding XKR7 function, implementation science approaches offer structured methods for resolution through improved experimental design:

Sources of Contradiction in XKR7 Research:
Common causes include:

  • Variable expression levels affecting stoichiometry of interactions

  • Cell type-specific cofactors influencing function

  • Species differences between human and Pan troglodytes XKR7

  • Post-translational modification differences

  • Methodological variations in experimental protocols

Resolution Through Experimental Design:
Implementation science frameworks suggest several approaches :

Interrupted Time Series (ITS) Design:
By collecting data at multiple time points before and after XKR7 introduction, researchers can identify temporal patterns that may explain contradictory results . This approach can reveal:

  • Adaptation responses that change over time

  • Threshold effects requiring minimum expression duration

  • Secondary effects that follow initial responses

Stepped Wedge Design:
This approach introduces XKR7 to different experimental units in a staggered fashion, allowing researchers to control for temporal confounding factors . Benefits include:

  • Distinction between XKR7-specific effects and time-dependent changes

  • Internal replication within a single experimental framework

  • Statistical power through within-unit comparisons

Practical Implementation Strategy:

  • Conduct systematic review of contradictory findings

  • Identify methodological differences across studies

  • Design factorial experiments testing multiple variables simultaneously

  • Implement blinded analysis to prevent confirmation bias

  • Perform multi-laboratory validation for key findings

This structured approach transforms contradictory data from a scientific obstacle into an opportunity for deeper mechanistic understanding of XKR7 function.

What considerations should guide the design of genetic modification studies involving XKR7 in model systems?

Designing genetic modification studies for XKR7 requires careful planning to ensure scientific validity while addressing the unique challenges of membrane protein biology:

Knockout/Knockdown Strategic Considerations:

ApproachAdvantagesLimitationsDesign Considerations
CRISPR/Cas9 KnockoutComplete protein eliminationPotential developmental effectsMultiple guide RNAs targeting different exons
Conditional KnockoutTemporal control of deletionSystem leakinessTissue-specific promoters for Cre expression
shRNA/siRNA KnockdownGraduated reduction in expressionIncomplete silencingMultiple targeting sequences to confirm phenotype
Dominant NegativeFunctional inhibition with protein presentMay affect related family membersTarget conserved functional domains

Rescue/Complementation Experimental Design:
For validating knockout phenotypes:

  • Use heterologous promoters to avoid interference with knockout strategy

  • Include Pan troglodytes and human XKR7 variants for comparative rescue

  • Test multiple expression levels to identify potential dosage effects

  • Include functional mutants to map critical residues/domains

Model System Selection:
Consider these factors when choosing genetic modification systems:

  • Evolutionary conservation of XKR7 pathway components

  • Tissue-specific expression patterns matching research questions

  • Technical feasibility of genetic manipulation

  • Availability of readouts for XKR7-dependent processes

Controls and Validation:
Essential controls include:

  • Off-target analysis through whole genome sequencing

  • Phenotypic comparison across multiple modified clones

  • Complementation with wildtype gene to confirm specificity

  • Assessment of compensatory mechanisms (e.g., upregulation of related XKR proteins)

Properly designed genetic modification studies represent the gold standard for defining XKR7 function in biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.