Recombinant Panax ginseng Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify it to allow for preferential development.
Synonyms
petA; PSC0639; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Panax ginseng (Korean ginseng)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPVDRISPEMKERIGNLSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVG KIIRKEKGGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Recombinant Panax ginseng Apocytochrome f (petA) and what is its fundamental structure?

Recombinant Panax ginseng Apocytochrome f (petA) is a protein derived from Korean ginseng (Panax ginseng) with UniProt identifier Q68RZ3. The protein consists of a specific amino acid sequence (YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPVDRISPEMKERIGNLSFQSYRPTKKNILVIGPVPGQKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVGKIIRKEKGGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF) . It is produced using recombinant technology to ensure consistency and purity for research applications. The expression region typically spans positions 36-320 of the full-length protein, and it may contain various tags depending on the production process .

How should researchers optimally store and handle Recombinant Panax ginseng Apocytochrome f (petA) in laboratory settings?

For optimal integrity and activity of the recombinant protein:

  • Standard storage: Maintain at -20°C in a Tris-based buffer with 50% glycerol

  • Extended storage: Store at -20°C or -80°C

  • Working solutions: Keep aliquots at 4°C for a maximum of one week

  • Avoid repeated freeze-thaw cycles as this significantly degrades protein structure and function

  • Handle the protein in appropriate buffer conditions optimized for this specific protein

What are the primary applications of Recombinant Panax ginseng Apocytochrome f (petA) in basic research?

The primary applications include:

  • Serving as a standard in ELISA-based detection systems

  • Investigating protein-protein interactions within photosynthetic pathways

  • Studying the unique properties of plant cytochromes from medicinal plants

  • Comparing structural and functional differences between plant species

  • Exploring the role of this protein in relation to the medicinal properties of Panax ginseng

These applications are particularly relevant when trying to understand the molecular mechanisms underlying the therapeutic effects of Panax ginseng, which include antioxidant, anti-inflammatory, and immunomodulatory properties .

How does Recombinant Panax ginseng Apocytochrome f (petA) differ from similar proteins in other medicinal plants?

While specific comparative data on Apocytochrome f across medicinal plants is limited, several key differences can be identified:

FeaturePanax ginseng Apocytochrome fOther Plant Cytochromes
Amino acid compositionContains specific sequence with characteristic CHLANK motifMay have variations in key functional regions
Post-translational modificationsSpecific to Panax speciesVary based on plant family and growth conditions
Stability profileRequires specific buffer conditionsStability requirements vary by species
Function in electron transportMay contribute to unique metabolic profiles of PanaxDifferent electron transport efficiencies

This differentiation is important when designing experiments to investigate how the unique properties of Panax ginseng contribute to its medicinal effects compared to other plants sometimes referred to as ginseng, such as American ginseng, Eleuthero, or Panax notoginseng .

What methodological approaches are most effective for studying potential interactions between Recombinant Panax ginseng Apocytochrome f (petA) and cytochrome P450 enzymes?

Based on methodologies used in related research, the following approaches are recommended:

  • In vitro enzyme inhibition/induction assays:

    • Use recombinant human CYP3A enzymes with probe substrates (e.g., midazolam)

    • Measure reaction kinetics in the presence of varying concentrations of Apocytochrome f

    • Determine IC50 or Ki values to quantify interaction strength

  • Cell-based reporter systems:

    • Transfect cells with CYP3A4 promoter-reporter constructs

    • Treat with Apocytochrome f and measure changes in reporter activity

    • Compare with known inducers/inhibitors as controls

  • Molecular docking studies:

    • Conduct in silico analysis of potential binding interactions

    • Validate predictions with site-directed mutagenesis of key residues

  • Crossover pharmacokinetic studies:

    • Similar to methodologies used in the Panax ginseng-midazolam interaction study

    • Measure pharmacokinetic parameters before and after Apocytochrome f exposure

This integrated approach would help determine if Apocytochrome f contributes to the observed induction of CYP3A activity seen with Panax ginseng administration (34% increase in midazolam clearance) .

How can metabolomic approaches be integrated with Recombinant Panax ginseng Apocytochrome f (petA) research to understand its broader biological impacts?

Integrating metabolomics with Apocytochrome f research can be achieved through:

  • HR-MAS NMR spectroscopy:

    • This technique requires minimal sample preparation and provides high reproducibility

    • Can detect subtle metabolic changes induced by protein administration

    • Particularly useful for analyzing small sample volumes (as low as 36 μL)

  • Multivariate statistical analysis:

    • Apply principal component analysis (PCA) and partial least squares discriminant analysis (PLS-DA)

    • Identify metabolite patterns that correlate with Apocytochrome f exposure

    • Generate variable importance in projection (VIP) scores to identify key affected metabolites

  • Biomarker identification:

    • Calculate area under the curve (AUC) values from receiver operating characteristic (ROC) curves

    • Focus on metabolites showing significant changes after protein exposure

    • Prioritize metabolites with VIP scores above 1.0 and AUC values above 0.9

  • Pathway analysis:

    • Map affected metabolites to known biochemical pathways

    • Identify potential connections to energy metabolism, immune function, or other physiological processes

    • Compare with changes observed in studies of whole Panax ginseng extract

This approach mirrors the successful metabolomic analysis of black ginseng effects in beagle dogs, which revealed significant changes in branched-chain amino acids, histidine, glutamine, and pyruvate levels related to immune function and energy metabolism .

What are the challenges and solutions in maintaining stability and functional integrity of Recombinant Panax ginseng Apocytochrome f (petA) during experimental procedures?

Key Challenges:

  • Protein degradation:

    • Cytochrome proteins are susceptible to oxidative damage

    • Heme group can be lost during purification or storage

  • Aggregation issues:

    • Membrane-associated proteins tend to aggregate in solution

    • Aggregation can mask functional epitopes

  • Functional assay limitations:

    • Difficulty in replicating native electron transport environment

    • Challenge of distinguishing specific activity from background

Methodological Solutions:

ChallengeSolution ApproachTechnical Details
Oxidative damageAntioxidant buffer additivesInclude 1-5 mM DTT or 2-mercaptoethanol in working solutions
Protein aggregationOptimize detergent conditionsTest various non-ionic detergents (0.01-0.1% range)
Thermal instabilityControlled temperature handlingMaintain at 4°C during all experimental procedures
Activity lossReconstitution with cofactorsInclude heme precursors in reconstitution buffer
Binding specificityPre-clearing lysatesUse species-matched control proteins to reduce non-specific binding

These approaches should be validated through activity assays specific to cytochrome function, such as spectrophotometric measurement of electron transfer capabilities or redox potential assessments.

How does Recombinant Panax ginseng Apocytochrome f (petA) potentially contribute to the immunomodulatory effects observed with whole Panax ginseng extracts?

While direct evidence for Apocytochrome f's role in immunomodulation is limited, several hypothetical mechanisms can be proposed based on known properties of cytochromes and observed effects of Panax ginseng:

  • Potential signaling pathway activation:

    • Cytochrome proteins can trigger specific cellular responses when recognized by immune cells

    • May activate similar pathways to those affected by ginsenosides in Panax ginseng

  • Influence on branched-chain amino acid (BCAA) metabolism:

    • Metabolomic studies show that Panax ginseng affects BCAA levels

    • BCAAs (isoleucine, leucine, valine) are crucial for lymphocyte growth and proliferation

    • Apocytochrome f may influence metabolic pathways involved in BCAA regulation

  • Antioxidant activities:

    • Cytochromes participate in redox reactions

    • May contribute to the documented antioxidant properties of Panax ginseng

    • Could protect immune cells from oxidative damage, enhancing their function

  • Interaction with pattern recognition receptors:

    • Plant proteins can interact with toll-like receptors and other immune sensors

    • May initiate immune signaling cascades similar to those stimulated by ginsenosides Rb1, Rc, and Re

To test these hypotheses, researchers should consider:

  • In vitro immune cell activation assays using isolated Apocytochrome f

  • Cytokine production measurements following exposure to the recombinant protein

  • Comparative studies between the recombinant protein and whole extract effects

  • Signaling pathway analysis using phosphoprotein arrays or reporter cell lines

What considerations should researchers make when designing experiments to investigate potential drug interactions involving Recombinant Panax ginseng Apocytochrome f (petA)?

When investigating drug interactions, researchers should consider:

  • Reference methodologies from established interaction studies:

    • Design similar to the midazolam-Panax ginseng interaction study

    • Use probe substrates for specific metabolic pathways (e.g., midazolam for CYP3A, fexofenadine for P-glycoprotein)

  • Thorough experimental design:

    • Include appropriate controls (positive, negative, vehicle)

    • Consider concentration-response relationships

    • Account for potential time-dependent effects (acute vs. chronic exposure)

  • CYP450 interaction potential:

    • Panax ginseng induces CYP3A activity with 34% decrease in midazolam AUC

    • Test if Apocytochrome f contributes to this effect

    • Investigate effects on CYP1A2, CYP2C9, and CYP3A4 specifically

  • P-glycoprotein consideration:

    • Whole Panax ginseng did not alter P-glycoprotein activity (no change in fexofenadine pharmacokinetics)

    • Determine if Apocytochrome f follows this pattern or differs

  • Clinical relevance threshold:

    • For CYP3A substrates, consider if effects exceed 30% change in pharmacokinetic parameters

    • For narrow therapeutic index drugs, smaller changes may be clinically significant

A comprehensive experimental approach should include both in vitro systems (microsomes, hepatocytes) and, if warranted by initial findings, in vivo models to assess the full spectrum of potential interactions.

How do various expression systems affect the structural and functional properties of Recombinant Panax ginseng Apocytochrome f (petA)?

Different expression systems can significantly impact the quality and properties of the recombinant protein:

Expression SystemAdvantagesLimitationsEffect on Apocytochrome f
E. coliHigh yield, low cost, rapid productionLimited post-translational modifications, potential inclusion bodiesMay lack plant-specific modifications, requires optimization of folding conditions
Yeast (P. pastoris)Moderate post-translational modifications, secretion possibleLonger production time, glycosylation patterns differ from plantsBetter folding than E. coli but still lacks plant-specific modifications
Insect cellsMore complex post-translational modifications, better foldingHigher cost, more complex protocolsImproved structural fidelity, but still differs from native plant protein
Plant-based expressionMost authentic post-translational modificationsLower yields, longer production timeMost closely resembles native Panax ginseng protein structure
Cell-free systemsAvoids cellular toxicity issues, rapidLimited post-translational modifications, high costUseful for preliminary studies or when protein is toxic to cells

Researchers should validate the chosen expression system by comparing the recombinant protein's key properties (spectral characteristics, electron transfer capability, binding affinities) with those of the native protein extracted directly from Panax ginseng when possible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.