Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; PSC0159; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGDILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI)?

Recombinant Panax ginseng ATP synthase subunit a, chloroplastic (atpI) is a protein component of the ATP synthase complex located in the chloroplasts of Panax ginseng (Korean ginseng). This protein is part of the F0 sector of ATP synthase and plays a crucial role in the generation of adenosine triphosphate (ATP), which provides chemical energy to maintain multiple cellular functions . The recombinant form of this protein is produced through expression systems to match the full-length native protein sequence (amino acids 1-247) and is used in various experimental settings to study ATP synthesis mechanisms and energy metabolism in Panax ginseng.

Methodologically, researchers working with this protein should understand that as part of the F0 sector, it is embedded in the membrane and functions in proton translocation, which is essential for the rotary mechanism of ATP synthesis.

How should Recombinant Panax ginseng ATP synthase subunit a be stored and handled in laboratory settings?

Proper storage and handling of Recombinant Panax ginseng ATP synthase subunit a are critical for maintaining its structural integrity and functional activity. The recombinant protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability . For storage, researchers should keep the protein at -20°C for regular use, or at -80°C for extended storage periods.

To preserve protein activity, it is crucial to avoid repeated freezing and thawing. Methodologically, researchers should:

  • Create multiple small aliquots upon receipt to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week only

  • Bring samples to room temperature gradually before use

  • Avoid vortexing, which can cause protein denaturation

  • Centrifuge briefly after thawing to recover all material

These handling precautions are particularly important for membrane proteins like ATP synthase subunit a, which tend to be less stable than soluble proteins when removed from their native lipid environment.

What are the alternative names and identifiers for this protein?

For comprehensive literature searches and database queries, researchers should be aware of all nomenclature associated with this protein:

  • Recommended name: ATP synthase subunit a, chloroplastic

  • Alternative names:

    • ATP synthase F0 sector subunit a

    • F-ATPase subunit IV

  • Gene name: atpI

  • ORF name: PSC0159

  • UniProt identifier: Q68S18

Methodologically, when conducting systematic reviews or meta-analyses of research involving this protein, using all these alternative identifiers in search strategies ensures comprehensive retrieval of relevant literature.

What is the functional role of ATP synthase in Panax ginseng energy metabolism?

ATP synthase plays a fundamental role in energy metabolism in Panax ginseng, particularly in aerobic cellular respiration. This enzyme complex catalyzes the final step of oxidative phosphorylation, synthesizing ATP from ADP and inorganic phosphate using the energy from a proton gradient across the membrane.

Research has demonstrated that ginsenosides, the major bioactive constituents of Panax ginseng, enhance mitochondrial respiration capacity and ATP production in various cell types . Specifically, total ginsenosides (GS) have been shown to:

  • Enhance mitochondrial respiration capacity

  • Increase ATP production in aerobic respiration-dominated cells

  • Promote tricarboxylic acid metabolism

  • Enhance NAD+-dependent SIRT1 activation, which increases mitochondrial biosynthesis

How can Recombinant Panax ginseng ATP synthase subunit a be used in studies of energy metabolism?

While atpI specifically refers to the chloroplastic ATP synthase, research with this recombinant protein can provide valuable insights into the broader ATP synthesis mechanisms in Panax ginseng. Methodologically, researchers can utilize this protein in multiple experimental approaches:

  • Protein-protein interaction studies: Using techniques such as co-immunoprecipitation or yeast two-hybrid assays to identify binding partners and regulatory proteins that interact with ATP synthase subunit a.

  • Structural studies: Employing X-ray crystallography or cryo-electron microscopy to elucidate the three-dimensional structure and understand the molecular mechanisms of proton translocation.

  • Antibody production: Generating specific antibodies against the recombinant protein for immunolocalization studies to determine the subcellular distribution of ATP synthase in different plant tissues.

  • Functional reconstitution experiments: Incorporating the purified protein into liposomes to study its role in proton translocation and ATP synthesis.

These approaches can be correlated with studies on the effects of ginsenosides on energy metabolism, as research has shown that ginsenosides enhance mitochondrial respiration capacity and ATP production , potentially through interactions with ATP synthase complexes.

What experimental approaches are most effective for studying the relationship between ATP synthase and ginsenoside-mediated effects on energy metabolism?

Based on current research methodologies, several experimental approaches have proven effective for investigating the relationship between ATP synthase and the energy-enhancing effects of ginsenosides:

  • Oxygen consumption measurement: Assessing cellular respiration using techniques such as high-resolution respirometry or Seahorse XF analyzers to quantify changes in oxygen consumption rate following ginsenoside treatment .

  • ATP quantification assays: Using luminescence-based assays to measure ATP production in different cellular compartments after exposure to various ginsenoside fractions.

  • Mitochondrial biosynthesis assessment: Evaluating the expression of key proteins involved in mitochondrial biogenesis (e.g., PGC-1α) through Western blotting or qPCR.

  • SIRT1 activity assays: Measuring the deacetylase activity of SIRT1, as ginsenosides have been shown to enhance NAD+-dependent SIRT1 activation, which increases mitochondrial biosynthesis .

  • Tricarboxylic acid (TCA) cycle metabolite analysis: Using metabolomics approaches to assess changes in TCA cycle intermediates following ginsenoside treatment.

Research has demonstrated that ginsenoside monomers such as Rg1, Re, Rf, Rb1, Rc, Rh1, Rb2, and Rb3 activate SIRT1 and promote energy metabolism . For ATP synthase-specific studies, researchers should consider combining these approaches with direct measurements of ATP synthase activity in isolated mitochondria or chloroplasts.

What are the key considerations for experimental design when studying ATP synthase function in the context of Panax ginseng's anti-fatigue properties?

When designing experiments to investigate ATP synthase function in relation to the anti-fatigue effects of Panax ginseng, researchers should consider several methodological factors:

  • Model selection: Choose appropriate experimental models that reflect the complexity of fatigue. Studies have utilized cell cultures (cardiomyocytes, neurons), animal models (mice, flies), and clinical trials with human subjects to examine different aspects of ginseng's anti-fatigue effects .

  • Stress induction protocols: Implement standardized protocols to induce fatigue, such as:

    • Exercise-induced fatigue models

    • Hypoxia or oxygen-glucose deprivation models

    • Chronic stress stimulation models

  • Biomarker selection: Measure relevant biomarkers of fatigue and energy metabolism, including:

    • Blood lactate and blood urea nitrogen levels

    • Hepatic glycogen levels

    • Glutathione peroxidase (GPH-Px) activity

    • Glucose (GLU) levels

  • Ginsenoside fractionation: Isolate and characterize specific ginsenoside fractions to determine structure-activity relationships, as different ginsenosides may have distinct effects on ATP synthase function.

  • Molecular pathway analysis: Investigate the SIRT1-PGC-1α pathway, which plays a protective role in hypoxia or oxygen-glucose deprivation-induced injuries and improves mitochondrial function .

Research has shown that GS pretreatment enhances mitochondrial respiration capacity and ATP production in aerobic respiration-dominated cells, and promotes tricarboxylic acid metabolism in cardiomyocytes . These findings suggest that ATP synthase activity is likely a key factor in the anti-fatigue effects of Panax ginseng.

What methodological considerations are important for purifying and characterizing functional Recombinant Panax ginseng ATP synthase?

Purifying and characterizing functional ATP synthase from Panax ginseng presents several methodological challenges due to its membrane-embedded nature and multi-subunit complexity. Researchers should consider the following approaches:

  • Expression system selection:

    • Plant-based expression systems may provide the most native post-translational modifications

    • Insect cell systems offer a compromise between yield and proper folding

    • Bacterial systems provide high yield but may require refolding protocols

  • Solubilization strategies:

    • Utilize mild detergents (DDM, LMNG) that maintain protein-protein interactions

    • Consider native nanodiscs or styrene-maleic acid lipid particles (SMALPs) to preserve the lipid environment

  • Purification techniques:

    • Affinity chromatography using strategically placed tags that don't interfere with function

    • Size exclusion chromatography to isolate intact ATP synthase complexes

    • Ion exchange chromatography for further purification

  • Functional validation:

    • ATP synthesis/hydrolysis assays to confirm enzymatic activity

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Structural integrity assessment via circular dichroism or limited proteolysis

  • Reconstitution methods:

    • Liposome reconstitution to assess function in a membrane environment

    • Nanodiscs for single-particle structural studies

The storage buffer composition (Tris-based buffer with 50% glycerol) mentioned in the available information suggests optimization for protein stability, which is crucial for maintaining the functional integrity of this complex protein.

How can researchers investigate the relationship between Panax ginseng ATP synthase and the SIRT1-PGC-1α pathway in the context of energy metabolism?

The relationship between ATP synthase and the SIRT1-PGC-1α pathway represents a promising area for understanding the molecular mechanisms behind Panax ginseng's effects on energy metabolism. Methodologically, researchers can investigate this relationship through:

  • Genetic manipulation studies:

    • Knockdown or overexpression of SIRT1 to assess effects on ATP synthase expression and activity

    • Site-directed mutagenesis of key residues in PGC-1α to identify regions important for regulating ATP synthase expression

  • Pharmacological intervention studies:

    • Treatment with SIRT1 activators or inhibitors (e.g., resveratrol, nicotinamide) to modulate the pathway

    • Combined treatment with ginsenosides and SIRT1 modulators to assess synergistic or antagonistic effects

  • Molecular interaction analyses:

    • Chromatin immunoprecipitation (ChIP) assays to determine if PGC-1α binds to promoter regions of ATP synthase genes

    • Co-immunoprecipitation studies to identify protein complexes involving SIRT1, PGC-1α, and transcription factors that regulate ATP synthase

Research has shown that GS enhances NAD+-dependent SIRT1 activation to increase mitochondrial biosynthesis in cardiomyocytes and neurons, which was completely abrogated by nicotinamide (a SIRT1 inhibitor) . Additionally, GS had protective effects against hypoxia- or oxygen-glucose deprivation-induced damage through activation of the SIRT1-PGC-1α pathway .

These findings suggest a mechanistic link between ginsenosides, the SIRT1-PGC-1α pathway, and mitochondrial function, which likely involves ATP synthase as a key component of the mitochondrial energy production machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.