Recombinant Panax ginseng Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
cemA; PSC0630; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLLYLASLVFLPWWISLSFNKSLESWVTNWWNTRQSEIFLNGIQEKNILEKF IELEEILLLEEMIKEYSETHLQNLRIGIHKETIQFIKIHNEDRIHTILHFSTNIICFVIL SGYSIWGNEELVILNSWAQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELIIGSVYKD FGFVHNDQILSGLVSTFPVILDTLFKFWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function

This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the cemA protein in Panax ginseng chloroplasts and what are its known functions?

The cemA (chloroplast envelope membrane protein A) in Panax ginseng is an integral membrane protein encoded by the chloroplast genome. It is located in the chloroplast envelope and plays crucial roles in several cellular processes:

  • Functions as part of the CO₂ uptake system in chloroplasts

  • Involved in proton transport across the chloroplast envelope membrane

  • May participate in maintaining chloroplast envelope integrity

The cemA gene has been identified as one of the highly variable regions across different species of the genus Cardamine, suggesting it might serve as a potential molecular marker for phylogenetic studies . This variability pattern is likely similar across Araliaceae, the family that includes Panax ginseng.

When studying cemA in Panax ginseng, researchers should note that the complete chloroplast genome of Panax ginseng contains approximately 156,000 bp, and the cemA gene is one of approximately 80 protein-coding genes identified in this genome . Comparative analysis across different Panax species can provide insights into the evolutionary conservation of this protein.

What methods are recommended for isolating chloroplast envelope proteins from Panax ginseng?

Isolation of chloroplast envelope proteins from Panax ginseng requires a multi-step approach to ensure high purity and yield:

Recommended protocol:

  • Plant material preparation:

    • Collect fresh young leaves (>5g) from 3-4 week old Panax ginseng seedlings

    • Grow plants under controlled conditions to minimize stress responses

  • Chloroplast isolation:

    • Homogenize leaf tissue in isolation buffer (0.3M mannitol, 10mM MOPS, 1mM EDTA, pH 7.4) with protease inhibitors (1mM PMSF, 5mM α-aminocaproic acid, 1mM benzamidine)

    • Filter homogenate through multiple layers of miracloth

    • Purify intact chloroplasts using Percoll gradient centrifugation (40%/80% Percoll)

  • Envelope membrane separation:

    • Lyse purified chloroplasts in hypotonic medium (10mM MOPS-NaOH, pH 7.8, 4mM MgCl₂) with protease inhibitors

    • Separate envelope membranes by sucrose gradient centrifugation

    • Collect the yellow band containing envelope proteins carefully with a pipette

  • Verification of purity:

    • Perform Western blot analysis using antibodies against markers for different chloroplast compartments:

      • HMA1 as an envelope marker

      • LHCP for thylakoid contamination

      • KARI for stromal contamination

The purity of the isolated envelope fraction is critical for downstream analyses, as cross-contamination from other cellular compartments may confound results, particularly when working with low-abundance proteins like cemA.

How is the cemA gene characterized within the complete chloroplast genome of Panax ginseng?

The cemA gene is an integral component of the Panax ginseng chloroplast genome, which exhibits the typical quadripartite structure of angiosperm chloroplast genomes:

Chloroplast genome structure of Panax ginseng:

  • Total length: 156,333-156,459 bp

  • Large single-copy (LSC) region: 86,028-86,566 bp

  • Small single-copy (SSC) region: 18,021-19,117 bp

  • Inverted repeat regions (IR): 25,551-26,108 bp (pair)

The cemA gene is located in the large single-copy (LSC) region of the chloroplast genome. Comparative analyses across Araliaceae chloroplast genomes have identified cemA as one of the regions with higher nucleotide diversity, making it potentially valuable for phylogenetic studies .

Characterization approaches:

  • Next-generation sequencing:

    • Use Illumina platforms to sequence the complete chloroplast genome

    • Libraries with an average length of 350 bp are recommended

    • Assemble using de novo methods with tools such as SPAdes v3.15.2

  • Annotation:

    • Use DOGMA (Dual Organeller GenoMe Annotator) for initial annotation

    • Manually refine gene boundaries by comparison with closely related species

    • Verify tRNA genes using tRNAscan-SE

  • Comparative analysis:

    • Align with other Panax species using mVISTA in Shuffle-LAGAN mode

    • Calculate nucleotide diversity (Pi) using DnaSP software

    • Compare boundary regions of IR/LSC and IR/SSC for structural variations

Analysis of nucleotide diversity in cemA across different Panax species can provide insights into evolutionary pressures and potential functional adaptations of this gene within the genus.

What expression systems are most effective for recombinant production of Panax ginseng cemA protein?

Recombinant production of chloroplast envelope membrane proteins like cemA presents significant challenges due to their hydrophobic nature and membrane integration requirements. Based on current research with similar proteins, the following expression systems should be considered:

1. Escherichia coli-based systems:

  • Advantages: High yield, cost-effectiveness, rapid growth

  • Challenges: Proper membrane protein folding, formation of inclusion bodies

  • Recommended approach:

    • Use C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Employ fusion tags (MBP, SUMO) to enhance solubility

    • Optimize induction conditions (temperature reduction to 16-18°C, low IPTG concentration)

    • Consider cell-free expression systems for highly toxic membrane proteins

2. Yeast expression systems (Pichia pastoris):

  • Advantages: Eukaryotic protein processing machinery, ability to handle membrane proteins

  • Challenges: Lower yields than E. coli, longer cultivation times

  • Recommended approach:

    • Use inducible promoters (AOX1) for controlled expression

    • Employ GFP fusion for rapid screening of properly folded proteins

    • Optimize media composition with appropriate lipids

3. Plant-based expression systems:

  • Advantages: Native-like folding environment, appropriate post-translational modifications

  • Challenges: Lower yields, longer production time

  • Recommended approach:

    • Use Nicotiana benthamiana transient expression system

    • Optimize codon usage for plant expression

    • Consider chloroplast transformation for envelope proteins

For analyzing cemA function, expression with appropriate tags for detection (His, FLAG) and characterization (GFP) is recommended. Purification protocols must be carefully optimized to maintain protein stability and function, typically using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin.

What structural features and experimental approaches are crucial for functional validation of recombinant cemA protein?

Functionally validating recombinant cemA protein requires a multifaceted approach addressing both structural integrity and biochemical activity:

Structural considerations:

  • Transmembrane topology prediction:

    • cemA likely contains multiple transmembrane domains

    • Use prediction tools (TMHMM, Phobius) combined with experimental validation

    • Employ PEGylation assays or cysteine scanning mutagenesis to verify topology

  • Protein-protein interaction domains:

    • Identify conserved motifs through multiple sequence alignments across species

    • Focus on regions with high conservation, which often indicate functional importance

Functional validation approaches:

ApproachMethodologyExpected OutcomesLimitations
Complementation assaysExpress cemA in cemA-deficient mutantsRescue of mutant phenotypeRequires viable mutants
Liposome reconstitutionIncorporate purified cemA into artificial liposomesDemonstration of transport activityTechnical challenges with membrane protein integration
ElectrophysiologyPatch-clamp analysis of membranes containing cemAIon conductance measurementsSpecialized equipment required
CO₂ uptake assaysMeasure CO₂ uptake in presence/absence of cemAAltered CO₂ transport ratesEnvironmental variables impact results

Analytical methods:

  • Circular dichroism spectroscopy to verify secondary structure

  • Blue native PAGE to examine complex formation

  • Mass spectrometry for protein interaction studies

  • Microscopy with fluorescent tags to confirm localization

When designing validation experiments, consider that recombinant cemA might require specific lipid environments to maintain native conformation and function, similar to other chloroplast envelope proteins.

How does the cemA gene sequence variation among different Panax species correlate with its functional adaptations?

The cemA gene exhibits notable sequence variation across Panax species, which may reflect evolutionary adaptations to different environmental conditions. Understanding this variation-function relationship requires integrated genomic and biochemical approaches:

Sequence variation analysis:

Research indicates that cemA is among the highly variable regions in chloroplast genomes of Araliaceae family members . Comparative analyses of chloroplast genomes from fifteen Cardamine species revealed cemA as one of the maximum variable regions , and similar patterns might exist within Panax species.

Methodological approach for correlation studies:

  • Comprehensive sequence analysis:

    • Perform multiple sequence alignment of cemA from various Panax species

    • Calculate nucleotide diversity (Pi) using DnaSP software

    • Identify variable sites and determine if variations are synonymous or non-synonymous

  • Structure prediction and modeling:

    • Generate 3D structural models using homology modeling

    • Map sequence variations onto protein structure

    • Identify if variations cluster in specific functional domains

  • Selection pressure analysis:

    • Calculate Ka/Ks ratios to determine if cemA is under positive, negative, or neutral selection

    • Previous studies on Panax chloroplast genomes suggested that genome dynamics are under selective pressure

  • Functional characterization:

    • Express recombinant cemA variants from different Panax species

    • Compare biochemical properties (proton transport rates, CO₂ uptake efficiency)

    • Correlate functional differences with specific sequence variations

Expected insights:

  • Identification of conserved residues essential for core cemA function

  • Understanding of species-specific adaptations that may relate to environmental factors

  • Potential discovery of structure-function relationships that could inform protein engineering

Research suggests that comparing these variations across Panax species that inhabit different geographical regions (like those in Korea, China, and Siberia) could reveal how cemA has adapted to support photosynthesis under varying environmental conditions.

What challenges exist in purifying and structurally characterizing recombinant chloroplast envelope membrane proteins like cemA?

Purification and structural characterization of recombinant chloroplast envelope membrane proteins present unique challenges that require specialized approaches:

Major purification challenges:

  • Low natural abundance:

    • Chloroplast envelope proteins constitute only 1-2% of total chloroplast proteins

    • This necessitates highly efficient recombinant expression systems

  • Membrane protein solubilization:

    • Selection of appropriate detergents is critical

    • Commonly used detergents for chloroplast membrane proteins:

      • n-Dodecyl-β-D-maltoside (DDM)

      • Digitonin

      • LDAO (Lauryldimethylamine oxide)

    • Detergent concentration must be optimized to prevent protein aggregation or denaturation

  • Maintaining native lipid environment:

    • Chloroplast envelope proteins often require specific lipids for function

    • Consider using lipid nanodiscs or amphipols for stabilization

    • Lipid composition may need to mimic the chloroplast envelope

Structural characterization challenges:

TechniqueSpecific Challenges for cemAPotential Solutions
X-ray crystallographyDifficult crystallization of membrane proteinsUse of fusion partners (T4 lysozyme), lipidic cubic phase methods
Cryo-EMSize limitations (cemA is relatively small)Expression as part of larger complexes, use of Fab fragments
NMR spectroscopySignal overlap in membrane environmentSelective isotope labeling, TROSY techniques
Hydrogen/deuterium exchange MSDetergent interference with mass detectionOptimize detergent removal prior to analysis

Recommended workflow:

  • Optimize expression using GFP fusion for rapid folding assessment

  • Employ affinity chromatography with careful detergent selection

  • Validate protein integrity by circular dichroism

  • Attempt structural characterization using complementary techniques

Researchers should note that the extraction procedure described in the literature for chloroplast envelope proteins can be adapted for recombinant cemA purification, with modifications to account for the expression system used.

How do post-translational modifications affect cemA function in Panax ginseng, and how can these be preserved in recombinant systems?

Post-translational modifications (PTMs) of cemA are critical for its proper localization, function, and regulation. Understanding and preserving these modifications in recombinant systems presents significant research challenges:

Known and predicted PTMs in chloroplast envelope proteins:

  • Lipid modifications:

    • Palmitoylation may anchor regions to the membrane

    • Prenylation could facilitate protein-protein interactions

  • Phosphorylation:

    • May regulate protein activity in response to environmental signals

    • Key for protein interaction network formation

    • May be involved in stress response pathways

  • Redox modifications:

    • Disulfide bond formation or reduction can modulate activity

    • May respond to chloroplast redox state during photosynthesis

Methodological approaches for PTM analysis:

  • PTM identification:

    • Mass spectrometry-based proteomics with enrichment strategies

    • Site-directed mutagenesis of potential modification sites

    • Specific antibodies against common PTMs

  • Functional significance:

    • Compare activity of modified vs. unmodified proteins

    • Analyze environmental conditions that trigger modifications

    • Assess protein-protein interactions dependent on PTMs

Preserving PTMs in recombinant systems:

Expression SystemPTM CapabilitiesLimitations for cemAOptimization Strategies
E. coliLimited PTM machineryLacks most eukaryotic PTMsEngineering of PTM enzymes into expression strain
YeastBasic eukaryotic PTMsDifferent PTM pattern than plantsHumanization of glycosylation pathways
Insect cellsMore complex PTMsNot plant-specificCo-expression of plant-specific modification enzymes
Plant expression systemsMost native PTMs possibleLower yieldsTransient expression in N. benthamiana
Cell-free systemsCustomizable additionsRequires supplementationAddition of microsomes or modification enzymes

When studying cemA function, researchers should consider that adaptogenic properties attributed to Panax ginseng may be partly influenced by the function of chloroplast proteins like cemA, which contribute to the plant's ability to respond to environmental stressors. Understanding how PTMs regulate cemA in response to these stressors could provide insights into the molecular basis of ginseng's adaptogenic properties.

What omics approaches can be integrated to comprehensively understand cemA function in Panax ginseng chloroplasts?

A multi-omics approach provides the most comprehensive understanding of cemA function within the complex biological system of Panax ginseng chloroplasts:

Integrated omics framework for cemA research:

  • Genomics:

    • Comparative analysis of cemA sequences across Panax species

    • Identification of regulatory elements in the chloroplast genome

    • Analysis of cemA evolution using phylogenomic approaches based on complete chloroplast genomes

  • Transcriptomics:

    • RNA-Seq analysis to determine if cemA is co-expressed with functionally related genes

    • Small RNA profiling to identify potential post-transcriptional regulation

    • Analysis of RNA editing sites that might affect cemA expression or function

  • Proteomics:

    • Quantitative proteomics to measure cemA abundance under different conditions

    • Interactome analysis to identify protein complexes containing cemA

    • Post-translational modification mapping using enrichment techniques coupled with MS/MS

    • Apply Enrichment Factor calculations as used in previous studies to confidently identify envelope proteins

  • Metabolomics:

    • Targeted metabolite profiling focusing on compounds affected by CO₂ uptake efficiency

    • Lipidomics to characterize the lipid environment of cemA in the chloroplast envelope

    • Analysis of metabolic shifts in cemA mutants or overexpression lines

Data integration approaches:

Integration MethodApplication to cemA ResearchExpected Outcomes
Network analysisConstruct protein-protein interaction networksIdentification of functional modules containing cemA
Multi-omics correlationCorrelate transcriptomic, proteomic and metabolomic changesComprehensive view of cemA regulation and impact
Machine learningPattern recognition across multiple data typesPrediction of conditions affecting cemA function
Systems biology modelingCreate mathematical models of processes involving cemASimulation of cemA function under various conditions

Experimental design considerations:

  • Include multiple time points to capture dynamic responses

  • Compare different tissues and developmental stages

  • Include environmental stress conditions (drought, temperature, light) to assess adaptability

  • Use both wild-type and genetically modified plants (cemA overexpression or knockdown)

The integration of these omics approaches would allow researchers to position cemA within the broader context of chloroplast and cellular function in Panax ginseng, potentially revealing unexpected roles beyond its known functions in CO₂ uptake and envelope membrane maintenance.

How can CRISPR-Cas technology be utilized to investigate cemA function in Panax ginseng?

CRISPR-Cas technology offers powerful approaches for investigating cemA function in Panax ginseng, though applying these techniques to chloroplast genes presents unique challenges and opportunities:

Chloroplast genome editing strategies:

  • Direct chloroplast genome editing:

    • Traditional CRISPR-Cas9 systems are ineffective for chloroplast genomes due to nuclear encoding

    • Alternative approaches:

      • Chloroplast-targeted ribonucleoproteins (RNPs)

      • Transplastomic expression of Cas9 and gRNAs

  • Nuclear-encoded regulators:

    • Target nuclear genes that regulate cemA expression or function

    • Focus on factors involved in chloroplast protein import and assembly

    • Modify pathways that interact with cemA-dependent processes

Experimental design for cemA functional studies:

ApproachMethodologyExpected OutcomesTechnical Considerations
Gene knockoutComplete or partial deletion of cemAPhenotypic consequences, physiological impactsMultiple chloroplast genome copies require homoplasmy
Base editingIntroduce point mutations to specific functional domainsStructure-function relationshipsPrecise editing required for specific amino acid changes
Transcriptional modulationCRISPRi targeting cemA promoterDose-dependent effects of reduced expressionChallenging to target chloroplast transcription machinery
Tagged versionsIn-frame insertion of epitope tags or fluorescent proteinsVisualization of localization, interaction partnersTag may interfere with protein function

Validation and analysis approaches:

  • Phenotypic analysis:

    • Photosynthetic efficiency measurements

    • CO₂ uptake assays

    • Growth characteristics under various environmental conditions

    • Assessment of stress tolerance parameters

  • Molecular characterization:

    • Transcriptome analysis of edited lines

    • Proteome analysis focusing on chloroplast envelope fractions

    • Metabolic profiling with emphasis on photosynthetic metabolites

  • Physiological assessment:

    • Measure effects on bioactive compound production

    • Analyze adaptogenic properties potentially linked to chloroplast function

    • Assess plant fitness under stress conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.