Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biosynthetic Role

OSCPNX1 belongs to the oxidosqualene cyclase (OSC) family, which converts 2,3-oxidosqualene into diverse triterpenoid scaffolds. Specifically, CAS catalyzes the formation of cycloartenol, the precursor for phytosterols (e.g., sitosterol, stigmasterol) and triterpene saponins like ginsenosides .

Key Reactions:

SubstrateProductPathwayBiological Role
2,3-OxidosqualeneCycloartenolPhytosterol biosynthesisMembrane integrity, signaling
Cycloartenol derivativesGinsenosidesTriterpene saponin synthesisAntioxidant, anticancer

This enzyme is distinct from dammarenediol synthase (DDS) and β-amyrin synthase (β-AS), which produce dammarane- and oleanane-type saponins, respectively .

3.1. Biotechnological Production

  • Overexpression Studies:

    • Transgenic Centella asiatica hairy roots expressing Panax ginseng FPS (PgFPS) showed 3-fold higher phytosterol content, correlating with upregulated CAS expression .

    • Co-expression of CAS with squalene synthase (SS) in P. notoginseng increased total ginsenosides by 1.5–2.4× .

3.2. Functional Insights

  • Substrate Specificity: OSCPNX1 exclusively produces cycloartenol, unlike multifunctional OSCs (e.g., lupeol synthase) .

  • Metabolic Engineering: Silencing β-AS in P. ginseng boosted dammarane-type ginsenosides (Rb1, Rg1) by diverting flux from oleanane pathways .

Comparative Analysis with Other OSCs

EnzymeProductSaponin TypeRole in Panax
Cycloartenol synthaseCycloartenolPhytosterolsMembrane structure
Dammarenediol synthaseDammarenediolDammarane-typeGinsenosides (Rb1, Rg1)
β-Amyrin synthaseβ-AmyrinOleanane-typeMinor saponins (e.g., Ro)

Challenges and Future Directions

  • Heterologous Expression: Low yield in bacterial systems due to enzyme complexity .

  • CRISPR Applications: Gene editing could optimize OSCPNX1 for high-value triterpene production .

This enzyme’s role in ginsenoside diversity underscores its potential in pharmaceutical and nutraceutical industries. Further structural studies and pathway engineering are needed to harness its full potential .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
The delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OSCPNX1; CAS; PNX; Cycloartenol Synthase; PgCAS; Phytosterol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Panax ginseng (Korean ginseng)
Target Names
OSCPNX1
Target Protein Sequence
MWKLKIAEGGNPWLRTLNDHVGRQIWEFDPNIGSPEELAEVEKVRENFRNHRFEKKHSAD LLMRIQFANENPGSVVLPQVKVNDGEDISEDKVTVTLKRAMSFYSTLQAHDGHWPGDYGG PMFLMPGLVITLSITGVLNVVLSKEHKREICRYLYNHQNRDGGWGLHIEGPSTMFGTVLN YVTLRLLGEGANDGQGAMEKGRQWILDHGSATAITSWGKMWLSVLGVFEWSGNNPLPPET WLLPYILPIHPGRMWCHRRMVYLPMSYLYGKRFVGPITPTVLSLRKEVFSVPYHEIDWNQ ARNLCAKEDLYYPHPLIQDILWASLDKVWEPIFMHWPAKKLREKSLRTVMEHIHYEDENT RYICIGPVNKVLNMLCCWVEDPNSEAFKLHLPRLHDFLWLAEDGMKMQGYNGSQLWDTAF AVQAIISTNLAEEYGPTLRKAHTFMKNSQVLDDCPGDLDAWYRHVSKGAWPFSTADHGWP ISDCTAEGFKAVLQLSKLPSELVGEPLDAKRLYDAVNVILSLQNSDGGYATYELTRSYSW LELVNPAETFGDIVIDYPYVECTSAAIQALTAFKKLFPGHRREEIQHSIEKAALFIEKIQ SSDGSWYGSWGVCFTYGTWFGIKGLVTAGRTFSSCASIRKACDFLLSKQVASGGWGESYL SCQNKVYTNLEGNRSHVVNTGWAMLALIDAGQAERDATPLHRAAKLLINSQMENGDFPQE EIMGVFDKNCMITYAAYRNIFPIWALGEYRCRVLQGPS
Uniprot No.

Target Background

Function
Cycloartenol synthase (OSCPNX1) is a component of the phytosterols biosynthetic pathways. It functions as an oxidosqualene cyclase, converting oxidosqualene to cycloartenol.
Protein Families
Terpene cyclase/mutase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1) and what is its primary function?

Recombinant Panax ginseng Cycloartenol Synthase (OSCPNX1), also known as PgCAS, is a full-length (758 amino acids) enzyme expressed in prokaryotic systems that catalyzes a critical cyclization reaction in phytosterol biosynthesis. It functions as a key component in the biosynthetic pathway that produces cycloartenol from 2,3-oxidosqualene, which serves as the first committed step in phytosterol and triterpene biosynthesis in Panax ginseng. The enzyme contains multiple functional domains that enable substrate binding, cyclization, and product release. OSCPNX1 belongs to the oxidosqualene cyclase family and serves as a branch point enzyme between sterol and triterpene saponin biosynthesis in P. ginseng .

How does OSCPNX1 contribute to ginsenoside production in Panax ginseng?

OSCPNX1 contributes to ginsenoside production by catalyzing the formation of cycloartenol, which serves as a precursor in the biosynthetic pathway leading to phytosterols and potentially to triterpene saponins (ginsenosides). While cycloartenol primarily feeds into the phytosterol pathway, research suggests interconnections between sterol and triterpene metabolism in P. ginseng. Ginsenosides, which include various bioactive compounds like Rb1, Rc, Re, and Rg1, derive from the cyclization of 2,3-oxidosqualene through different oxidosqualene cyclases. The regulation of OSCPNX1 activity may influence carbon flux between competing pathways, potentially affecting the production of ginsenosides that exhibit important pharmacological properties including antioxidant, antitumor, and immunomodulatory activities .

What are the structural characteristics of OSCPNX1 that enable its function?

The structural characteristics of OSCPNX1 include:

Domain/RegionPositionFunction
N-terminal domain1-250Membrane association and protein stabilization
Catalytic domain251-550Contains the active site for cyclization
QW-motifsMultiple locationsSubstrate recognition and binding
DCTAE motifAround position 485-489Critical for catalytic activity

OSCPNX1 contains the conserved amino acid sequence MWKLKIAEGGNPWLRTLNDHVGRQIWEFDPNIGSPEELAEVEKVRENFRNHRFEKKHSADLLMRIQFANENPGSVVLPQVKVNDGEDISEDKVTVTLKRAMSFYSTLQAHDGHWPGDYGGPMFLMPGLVITLSITGVLNVVLSKEHKREICRYLYNHQNRDGGWGLHIEGPSTMFGTVLNYVTLRLLGEGANDGQGAMEKGRQWILDHGSATAITSWGKMWLSVLGVFEWSGNNPLPPETWLLPYILPIHPGRMWCHRRMVYLPMSYLYGKRFVGPITPTVLSLRKEVFSVPYHEIDWNQARNLCAKEDLYYPHPLIQDILWASLDKVWEPIFMHWPAKKLREKSLRTVMEHIHYEDENTR and continues through position 758, featuring multiple conserved regions characteristic of oxidosqualene cyclases that facilitate proper folding and catalytic function .

What expression systems are most effective for producing active OSCPNX1?

The E. coli expression system has proven effective for producing recombinant OSCPNX1, as indicated by commercial availability of the enzyme produced using this method . For optimal expression, researchers should consider the following methodological approach:

  • Vector selection: pET-series vectors containing T7 promoters provide strong induction capabilities

  • Host strain optimization: BL21(DE3) or Rosetta strains accommodate the plant codon usage

  • Expression conditions:

    • Induction at OD600 = 0.6-0.8

    • IPTG concentration: 0.1-0.5 mM

    • Expression temperature: 16-20°C for 16-20 hours (reducing temperature from 37°C significantly improves soluble protein yield)

    • Supplementation with 1% glucose to reduce basal expression

Alternative expression systems including yeast (Pichia pastoris) may offer advantages for proper folding of this complex enzyme, particularly when full catalytic activity is required for downstream applications.

What purification strategies yield the highest purity and activity of OSCPNX1?

A multi-step purification strategy is recommended to obtain high-purity, active OSCPNX1:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged protein

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Imidazole gradient: 20-250 mM

  • Intermediate purification: Ion exchange chromatography

    • Q-Sepharose column equilibrated with 20 mM Tris-HCl pH 8.0

    • Elution with 0-500 mM NaCl gradient

  • Polishing: Size exclusion chromatography

    • Superdex 200 column

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT

Critical considerations include maintaining reducing conditions throughout purification (2-5 mM β-mercaptoethanol or 1 mM DTT) to prevent oxidation of catalytically important cysteine residues, and inclusion of 5-10% glycerol to enhance protein stability. Throughout purification, enzyme activity should be monitored using appropriate assays to ensure functional integrity is maintained.

How can researchers verify the functional integrity of recombinant OSCPNX1?

Verification of OSCPNX1 functional integrity requires multiple complementary approaches:

  • Enzymatic activity assay:

    • Substrate: 2,3-oxidosqualene

    • Reaction conditions: 50 mM Tris-HCl pH 7.4, 0.1% Triton X-100, 2 mM DTT

    • Product detection: HPLC or GC-MS analysis of cycloartenol formation

  • Spectroscopic analyses:

    • Circular dichroism to confirm proper secondary structure

    • Fluorescence spectroscopy to assess tertiary structure

  • Thermal shift assay:

    • Assess protein stability under various buffer conditions

    • Determine melting temperature (Tm) as quality control parameter

  • Substrate binding analysis:

    • Isothermal titration calorimetry (ITC) to determine binding constants

    • Surface plasmon resonance (SPR) for real-time binding kinetics

A functionally intact OSCPNX1 should demonstrate specific cyclization activity converting 2,3-oxidosqualene to cycloartenol with kinetic parameters comparable to published values for other plant cycloartenol synthases. Comparison with wild-type enzyme activity, if available, provides the most reliable reference point.

What are the most reliable assays for measuring OSCPNX1 enzymatic activity?

Several complementary assays can be employed to reliably measure OSCPNX1 enzymatic activity:

  • Radiometric assay:

    • Substrate: [14C]-labeled 2,3-oxidosqualene

    • Analysis: TLC separation followed by autoradiography

    • Quantification: Liquid scintillation counting of excised spots

  • GC-MS based assay:

    • Reaction products extracted with organic solvent (hexane or ethyl acetate)

    • Derivatization: Silylation with BSTFA

    • Detection: GC-MS analysis with selected ion monitoring

  • LC-MS/MS assay:

    • HPLC separation on C18 column

    • MS/MS detection using multiple reaction monitoring

    • Quantification using standard curves of authentic cycloartenol

  • Coupled enzyme assay:

    • Coupling cycloartenol formation to a secondary reaction

    • Spectrophotometric measurement of reaction progress

For the most accurate and sensitive measurement, the LC-MS/MS approach offers superior specificity and sensitivity with limits of detection in the nanomolar range. When designing activity assays, researchers should include appropriate detergents (0.1% Triton X-100) to solubilize the lipophilic substrate and ensure that reducing conditions are maintained to preserve enzyme activity .

How can isotope labeling be used to study OSCPNX1-catalyzed reactions?

Isotope labeling provides powerful insights into OSCPNX1-catalyzed reactions through several methodological approaches:

  • Mechanism elucidation:

    • Deuterium-labeled substrates to track hydrogen transfers

    • 13C-labeled precursors to trace carbon skeletal rearrangements

    • Analysis of isotopologues by NMR and MS to determine reaction mechanisms

  • In vivo pathway analysis:

    • 13CO2 labeling of intact P. ginseng plants

    • Administration of [U-13C6]glucose to root cultures

    • Analysis of resulting isotopologue patterns in end products

  • Kinetic isotope effect studies:

    • Comparison of reaction rates with labeled vs. unlabeled substrates

    • Determination of rate-limiting steps in the cyclization reaction

The incorporation patterns observed in isotope labeling experiments can reveal crucial details about the cyclization mechanism. For example, the study of polyacetylene biosynthesis in P. ginseng using 13CO2 and [U-13C6]glucose revealed specific labeling patterns that supported the decarboxylation of fatty acids as the biosynthetic route . Similar approaches can be applied to study OSCPNX1-mediated cycloartenol formation and subsequent modifications leading to diverse triterpene structures.

What factors affect the catalytic efficiency of OSCPNX1 and how can they be optimized?

Multiple factors influence OSCPNX1 catalytic efficiency that can be systematically optimized:

FactorOptimal ConditionImpact on Activity
pH7.0-7.5>80% of maximum activity
Temperature25-30°CBalance between activity and stability
Divalent cationsMg2+ (1-5 mM)Enhances substrate binding
Reducing agentsDTT (1-2 mM)Maintains thiol groups in reduced state
Detergents0.1% Triton X-100Solubilizes substrate without denaturing enzyme
Substrate concentration50-100 μMBelow inhibitory levels

To optimize catalytic efficiency, researchers should conduct systematic variation of these parameters using response surface methodology. Additionally, protein engineering approaches such as directed evolution or rational design based on structural insights can significantly enhance OSCPNX1 performance. For example, modifications to enhance membrane association domains or substrate binding regions may improve catalytic parameters. The addition of specific chaperones during expression may also improve folding and activity of the recombinant enzyme.

How can OSCPNX1 be engineered to enhance production of specific triterpene compounds?

Engineering OSCPNX1 to enhance production of specific triterpene compounds requires multiple sophisticated approaches:

  • Structure-guided mutagenesis:

    • Target residues in the active site cavity that influence product specificity

    • Modify residues involved in the initial carbocation formation and stabilization

    • Engineer protein dynamics affecting conformational changes during catalysis

  • Domain swapping:

    • Create chimeric enzymes with domains from other OSCs with different product profiles

    • Focus on regions determining the stabilization of reaction intermediates

  • Directed evolution:

    • Develop high-throughput screening methods for desired products

    • Apply error-prone PCR, DNA shuffling, or CRISPR-based systems

    • Iterative selection for enzymes with enhanced production of target compounds

  • Computational design:

    • Molecular dynamics simulations to predict mutations affecting product specificity

    • Quantum mechanical/molecular mechanical (QM/MM) calculations to model transition states

    • Machine learning approaches to predict beneficial mutations

When successfully engineered, OSCPNX1 variants could redirect carbon flux from cycloartenol toward other triterpene scaffolds that serve as precursors for rare or novel ginsenosides with enhanced bioactivities . This approach could potentially yield compounds with stronger antioxidant, antitumor, or immunomodulatory properties.

What are the potential applications of OSCPNX1 in synthetic biology platforms?

OSCPNX1 offers several applications in synthetic biology platforms:

  • Heterologous production systems:

    • Integration into yeast or bacteria for sustainable production of cycloartenol

    • Combination with other enzymes to create complete biosynthetic pathways

    • Metabolic engineering to enhance precursor supply and product yield

  • Platform for novel compound discovery:

    • Combinatorial biosynthesis with different tailoring enzymes

    • Generation of unnatural triterpene scaffolds

    • Exploration of structure-activity relationships

  • Biocatalytic applications:

    • Cell-free enzymatic systems for specific transformations

    • Immobilized enzyme technology for continuous production

    • Multi-enzyme cascade reactions in artificial cellular compartments

  • Biosensors and screening tools:

    • Development of OSCPNX1-based biosensors for detection of pathway intermediates

    • High-throughput screening platforms for enzyme engineering

A particularly promising application involves reconstructing the early ginsenoside biosynthetic pathway in yeast by expressing OSCPNX1 alongside other key enzymes. This approach could provide sustainable production of rare ginsenosides with specific medicinal properties, such as enhanced antioxidant or antitumor activities . The implementation would require careful optimization of expression levels, precursor supply, and product export mechanisms.

What are common pitfalls in OSCPNX1 expression and how can they be avoided?

Researchers frequently encounter several challenges when expressing OSCPNX1:

  • Insoluble protein formation:

    • Problem: Formation of inclusion bodies due to improper folding

    • Solution: Reduce expression temperature to 16-18°C, use specialized E. coli strains (Rosetta, Arctic Express), co-express with chaperones (GroEL/ES), or add solubility tags (MBP, SUMO)

  • Low yield:

    • Problem: Poor expression levels despite optimization

    • Solution: Codon optimization for the expression host, use of stronger promoters, optimization of media composition (addition of rare amino acids or trace elements)

  • Proteolytic degradation:

    • Problem: Fragmented protein observed during purification

    • Solution: Add protease inhibitors (PMSF, EDTA, leupeptin), use protease-deficient strains, optimize harvest and lysis conditions to minimize exposure to proteases

  • Loss of activity:

    • Problem: Purified protein shows limited catalytic function

    • Solution: Maintain reducing environment throughout purification, include stabilizing agents (glycerol, specific substrates), purify at 4°C, minimize freeze-thaw cycles

  • Expression toxicity:

    • Problem: Decreased growth rate or cell death upon induction

    • Solution: Use tightly controlled expression systems, reduce inducer concentration, employ autoinduction media for gradual protein production

Careful optimization of these parameters and implementation of the suggested solutions can significantly improve OSCPNX1 expression outcomes.

How can researchers optimize in vitro reactions involving OSCPNX1?

Optimization of in vitro reactions with OSCPNX1 requires systematic attention to multiple parameters:

  • Reaction buffer optimization:

    • Test various pH ranges (6.5-8.0) and buffer systems (HEPES, Tris, phosphate)

    • Include divalent cations (Mg2+, Mn2+) at various concentrations (1-10 mM)

    • Optimize ionic strength with different NaCl or KCl concentrations

  • Substrate presentation:

    • Evaluate different detergent systems (Triton X-100, CHAPS, digitonin)

    • Test mixed micelle systems or liposome incorporation

    • Optimize substrate:detergent ratios

  • Enzyme stabilization:

    • Include antioxidants (DTT, β-mercaptoethanol)

    • Add glycerol or other osmolytes (10-20%)

    • Test protein-stabilizing additives (BSA, PEG)

  • Reaction monitoring:

    • Establish time-course analysis for optimal reaction duration

    • Determine product inhibition thresholds

    • Develop methods for continuous monitoring of activity

  • Scale-up considerations:

    • Surface area to volume ratios

    • Mixing parameters and oxygen effects

    • Temperature control for exothermic reactions

By systematically varying these parameters and using statistical design of experiments (DoE) approaches, researchers can identify optimal conditions that maximize OSCPNX1 activity while maintaining enzyme stability throughout the reaction period.

What are appropriate controls for experiments involving OSCPNX1?

Rigorous experimental design with OSCPNX1 requires multiple levels of controls:

  • Enzyme-related controls:

    • Heat-inactivated OSCPNX1 (95°C for 10 minutes)

    • Catalytically inactive mutant (mutation in the DCTAE motif)

    • Empty vector-expressed and purified in parallel with OSCPNX1

  • Substrate controls:

    • No-substrate reactions to detect background activity

    • Alternative substrates to assess specificity

    • Substrate stability controls (substrate incubated under reaction conditions without enzyme)

  • Product verification controls:

    • Authentic standards of expected products

    • Isotopically labeled substrates to track reaction progress

    • Enzyme concentration dependence to confirm enzyme-catalyzed reaction

  • System-specific controls:

    • Buffer-only controls

    • Impact of additives on assay readout

    • Potential interfering substances

  • Statistical controls:

    • Biological replicates (different protein preparations)

    • Technical replicates (multiple reactions from same preparation)

    • Time-course sampling to establish reaction kinetics

When designing experiments to study OSCPNX1 function in relation to ginsenoside biosynthesis, researchers should include additional plant oxidosqualene cyclases (e.g., β-amyrin synthase) as comparative controls to understand the specificity and efficiency of different cyclization reactions that contribute to diverse triterpene scaffolds in P. ginseng .

How to troubleshoot inconsistent results in OSCPNX1 substrate specificity studies?

When confronting inconsistent results in OSCPNX1 substrate specificity studies, researchers should implement the following troubleshooting protocol:

  • Substrate quality assessment:

    • Verify substrate purity by HPLC and NMR

    • Check for oxidation of sensitive functional groups

    • Ensure proper solubilization and presentation

  • Enzyme quality verification:

    • Confirm protein integrity by SDS-PAGE and mass spectrometry

    • Assess batch-to-batch variability through activity assays

    • Verify correct folding through circular dichroism spectroscopy

  • Analytical method validation:

    • Run standard curves with each analytical batch

    • Check for matrix effects in complex samples

    • Validate extraction efficiency and recovery rates

  • Experimental parameter control:

    • Maintain precise temperature control (±0.5°C)

    • Monitor and control oxygen levels

    • Standardize mixing conditions and vessel types

  • Systematic variation approach:

    • Change one parameter at a time

    • Use internal standards to normalize results

    • Implement factorial design to identify parameter interactions

When inconsistencies persist despite these measures, consider consulting literature on related enzymes such as those involved in the biosynthesis of panaxynol and panaxydol . The isotope labeling approaches successfully employed for elucidating these biosynthetic pathways may provide valuable methodological insights applicable to OSCPNX1 studies.

What are the most promising research directions for understanding OSCPNX1 function in relation to medicinal properties of Panax ginseng?

Several promising research directions emerge for understanding OSCPNX1's relationship to P. ginseng's medicinal properties:

  • Structure-function studies:

    • Determine the crystal structure of OSCPNX1

    • Identify key residues controlling product specificity

    • Elucidate the molecular basis for reaction mechanism

  • Systems biology approaches:

    • Transcriptomic analysis correlating OSCPNX1 expression with ginsenoside profiles

    • Metabolic flux analysis to quantify carbon allocation between competing pathways

    • Network modeling of triterpene biosynthesis regulation

  • In planta manipulation:

    • CRISPR/Cas9 editing of OSCPNX1 in P. ginseng

    • RNAi or overexpression studies to alter OSCPNX1 levels

    • Assessment of resultant changes in phytosterol and ginsenoside profiles

  • Medicinal chemistry integration:

    • Correlate altered OSCPNX1 activity with specific bioactivities

    • Investigate structure-activity relationships of novel compounds

    • Target specific medicinal properties (antioxidant, antitumor) through pathway engineering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.